KEGG   Herbaspirillum seropedicae SmR1: Hsero_0741
Entry
Hsero_0741        CDS       T01268                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
hse  Herbaspirillum seropedicae SmR1
Brite
KEGG Orthology (KO) [BR:hse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hse02044]
    Hsero_0741
Secretion system [BR:hse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Hsero_0741
SSDB
Motif
Pfam: T6SS_VipA SPT16 EnY2
Other DBs
NCBI-ProteinID: ADJ62260
UniProt: D8IZE0
Position
809942..810442
AA seq 166 aa
MAKRESIQKKLQKVRPPRVQMTYDVEIGDAIEKKELAFVTGVVGDFGGNSEVPQPRLKDR
KFVNVDPDNFDEVMKAIEPRAVYRVPNELSDKGGEFAVELKFRSMEDFRPEAVVQQVEPL
RKLLEARTKLADLRNKIAGNDKLEDILNDVLNSTEKLAELRQQTNK
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcaaaaagagaaagcatccagaagaaactccagaaggtccgtcccccgcgtgtgcag
atgacctatgacgtcgagatcggcgacgcgatcgagaagaaggaactggccttcgtcacc
ggcgtggtcggtgatttcggcggcaattcggaagtgccgcagccgcgcctgaaggaccgc
aagttcgtcaatgtcgatcccgacaatttcgatgaggtcatgaaggccatcgaaccacgc
gccgtctatcgcgtgcccaacgaactttccgacaagggcggcgaattcgcggtggaactg
aagttccgctcgatggaggatttccgtcccgaggcggtggtgcaacaggtcgaaccgctg
cgcaagctgctcgaagcccgcaccaagctggccgacctgcgtaacaagatcgccggcaac
gacaagctggaagacatcctcaacgatgtgctcaacagtaccgaaaagctcgccgagctg
cgtcagcaaaccaacaagtaa

DBGET integrated database retrieval system