KEGG   Herbaspirillum seropedicae SmR1: Hsero_0742Help
Entry
Hsero_0742        CDS       T01268                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
hse  Herbaspirillum seropedicae SmR1
Brite
KEGG Orthology (KO) [BR:hse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hse02044]
    Hsero_0742
Secretion system [BR:hse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Hsero_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB Spatacsin_C
Motif
Other DBs
NCBI-ProteinID: ADJ62261
UniProt: D8IZE1
Position
810454..811941
Genome map
AA seq 495 aa AA seqDB search
MSAQLHSETAAAPAAASASLLDDIVEQSKVAKSASEHDRAKDLITELVNQVMEGTVVVSS
NLSATLDARIAELDKLISSQVSAIMHAPEFQKLEGSWTGLNYLVRNTTVGENQKIKILNA
TKKELVKDFNSALEFDQSAMFKKVYEEEFGTFGGAPFGVLLGDFEITRQPEDMYFIEQMS
RIAAASHAPFVTAASPELFGLESYADLGKPRDLSKVFDTVEYAKWKSFRESEDSRYVGLT
LPRFLGRLPFNPKDGTTVEGFNFVEDVDGSDHSKYLWCNAAYAFGTKLTKAFEDFGWCAA
IRGVEGGGLVEDLPTHTFKTDEGEVALKCPTEIAITDRREKELSDLGFISLVHCKNTDYA
AFFGAQSAQKPKKYNTDSANANAVLSSQLQYIFAVSRIAHYMKSMMRDKIGSFAAASNVE
DFLNRWISQYVLLDDNATQEAKAQFPLREASVQVSEVPGRPGVYRAVSFLRPHFQLDELS
VSLRLVAELPQAGKS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcaactccattccgaaacggcagctgcccccgcagcggccagcgccagcctg
ctggacgatatcgtcgaacagagcaaggtcgccaagtccgcctctgaacatgaccgtgcc
aaggacctcatcaccgaactggtgaaccaggtcatggaggggacggtggtggtctccagc
aatctctcggcgacgctggatgcccgtattgcagagctggacaagttgatctccagccag
gtcagcgccatcatgcacgcgccggaattccagaagctggaaggcagctggaccggcctg
aactacctggtgcgcaacaccacggtgggcgagaaccagaagatcaagatcctcaacgcc
accaagaaggaactggtcaaggacttcaactccgcactggaattcgaccagagcgccatg
ttcaagaaggtctacgaagaagaattcggcaccttcggtggcgctcccttcggcgtgctg
ctgggcgatttcgagatcacccgccagcccgaggacatgtatttcatcgagcagatgtcg
cgcattgccgcggcctcgcacgcgcccttcgtcacggccgcctcgcccgaactgttcggc
ctggagtcctatgccgacctgggcaagccgcgcgacctctccaaggtcttcgatacggtg
gaatacgccaagtggaagtccttccgggaatccgaggattcccgctatgtcggcctgacc
ctgccgcgcttcctgggccgcctgccgttcaaccccaaggatggcaccacggtcgaaggc
ttcaatttcgtcgaggacgtcgacggcagcgaccattccaaatacctctggtgcaacgcc
gcctacgccttcggcaccaagctgaccaaggccttcgaggacttcggctggtgcgcggcg
attcgcggtgtggaaggcggcggcctggtggaagacctgccgacccacaccttcaagacc
gacgagggcgaagtggcgctgaagtgccccaccgaaatcgccatcaccgaccgccgtgaa
aaggagctctccgacctgggcttcatctcgctggtgcattgcaagaacaccgactacgcc
gccttcttcggcgcgcagtccgcgcagaagccgaagaagtacaacaccgattcggccaac
gccaatgcagtcctgtcgtcccagctgcaatacatcttcgccgtctcgcgcatcgcccac
tacatgaaatcgatgatgcgcgacaagatcggcagctttgccgctgcctccaacgtggaa
gatttcctcaatcgctggatctcccaatacgtgctgctggatgacaatgccacgcaggaa
gccaaggcgcagttcccgttgcgcgaggcttcggtacaggtgtcggaagtgccgggacgg
ccgggcgtctatcgcgccgtgtcgttcctgcgtccgcattttcagctggatgaactgtct
gtgtcgctgcgcctggtggcggagctgccgcaggccggcaagtcctga

DBGET integrated database retrieval system