KEGG   Herbaspirillum seropedicae SmR1: Hsero_0744Help
Entry
Hsero_0744        CDS       T01268                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
hse  Herbaspirillum seropedicae SmR1
Brite
KEGG Orthology (KO) [BR:hse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hse02044]
    Hsero_0744
Secretion system [BR:hse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Hsero_0744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25 CcmE
Motif
Other DBs
NCBI-ProteinID: ADJ62263
UniProt: D8IZE3
Position
812608..813096
Genome map
AA seq 162 aa AA seqDB search
MKGFAPSLFDRLMHESDRVSPNTVVSRLSIEELKDAVARDLEAMLNTRAVIPEQLFRHFP
ECSKSIIAYGLNDFAGMSLASLDDRAAICRSLEEAIARHEPRLRNVRASLEVQEGSINRL
NFAISALLVVNAAREAVSFDAVLQPSSLQYSISKGRATRIGV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggctttgctcccagcctctttgacaggctcatgcacgagagcgaccgggtgtcg
cccaataccgtggtcagccgcctgtcgatcgaagaactcaaggacgccgtggcccgcgac
ctcgaggccatgctcaatacgcgcgccgtgatcccggaacagctgttccggcattttccc
gaatgcagcaaatccatcattgcctatggtctgaacgacttcgccggcatgagcctggcc
agcctcgatgaccgcgccgccatctgccgctcgctggaagaggcgatcgcccgccacgag
ccgcgcctgcgcaatgtgcgcgcctccctggaggtgcaggaaggcagcatcaaccgtctc
aatttcgccatcagcgccttgctggtcgtcaatgcggcccgcgaggcggtcagcttcgac
gccgtgctgcagccttccagcctgcagtattcgatcagcaaggggcgcgccacgcgcata
ggagtctaa

DBGET integrated database retrieval system