KEGG   Herbaspirillum seropedicae SmR1: Hsero_0758Help
Entry
Hsero_0758        CDS       T01268                                 

Definition
(GenBank) transmembrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Hsero_0758
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hse02044]
    Hsero_0758
Secretion system [BR:hse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Hsero_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C MMR_HSR1 TadE MHYT Halogen_Hydrol
Motif
Other DBs
NCBI-ProteinID: ADJ62277
UniProt: D8IZF7
Position
complement(833419..837294)
Genome map
AA seq 1291 aa AA seqDB search
MQRLWHFLSDTRTLVIIGFAALAAFLFIGASTLELALTWAAVILAIALLCWLGYWLYRRW
KVRRAAGKLGEVLEQQATQSVAASSDGAQREEVAALRTRMLEAINTIKTSKLGQKSGSAA
LYELPWYMVIGNPAAGKSTAIANSGLQFPFADKGGKIVHGVGGTRNCDWFFTTDGILLDT
AGRYSVYEEDRNEWFSFLGLLKRYRKQAPINGIIIAVSIAELTGNRPEFAINLAKNLRQR
VQELTEKLEVFAPVYVVFTKADLITGFNEFFLDTERSERDRVWGATLAYDRKRSGQEVVS
FFDERFDELYAGLKEMSLASMSVKRGENMAPGVLTFPLEFSSIKGVLRSFVATLFEENPF
QFKPVFRGFYFTSAVQEGATVSASSQRIADRFGLALEHKPQREIFSQHGFFLHNLFKQVI
FADKQLVAQYTSRTKIRMRYATFFAAIAILGVLLGGWSWSYMGNRQLLANVQADMDKAVK
LQEKRLDLQSRFEALEILQDRIEQLDRYRASRPISVGMGLYQGDLLERKLREEYFSGIKE
IMLKPVASNIESYLMEVNANAARLEPMSRPPQSGGITPVADNGAQAASALRTYKDSSATS
VEDAYNALKTYLMLADKSRAESSHLNDQITRFWRGWLETNRGTMPREQMIRSAERLISFS
LEQINDPSWPTIDNKLTLVDQARENLRRVVRGMPARERVYADVKARAATRFASMTVARIV
GDKDRELVMGSYAIPGTFTRDAWEKFVQEAFKEAANKELQSADWVLKTSAKDDLTLEGSP
EQIQKALVTQYKTEYAREWQKFLQGVSIVELRNLDDATNAMNRLGDPITSPMKKVINTVY
DETSWDNPSLVDAGLANAKSGFMGWFKETILRRSPAPAPTQFNADGTTAIPMGPVGREFS
GVARLVVSKDKNGSLLQTYLDNLSKLRTRLNTIKNQGDTGPGAKQLMQQTLEGNGSELSD
SLKFVDEEMLPGLNDQQKTVLRPLLVRPLVQGFNALVRPTEGEVNKIWRAQVYEPFQSNL
AAKYPFSPNSKIEANSGEIGTVFGENGAISKFVTTAMGPLVVRRGDTLSPRKWADMGINL
SPAITSNFASWISAPGGGGDANGGANSAQTVFQIQPQPAPGALEYTIEIDGQQLRYRNTQ
AQWTNFIWPNPQGTPGARVTAQTYDGRTIEVASQPGRFGLERLINSAQRKRKDNGVFELS
WTNEGVTVVVNLKIISSAEVSGTANGPARGTASLRGLKLPETIAGGAPAPVLAPAPAGAA
GTAPMQPGQPMATDAAAPQSNNQPTITGVKQ
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgactctggcacttcctcagcgatacccgcaccctggtcatcatcggcttcgcc
gccctggccgcattcctcttcatcggcgccagcaccctggagctggccctgacctgggcc
gccgtgatcctggccatcgccctgctatgctggctgggatactggctgtaccggcgctgg
aaggtgcggcgcgccgccggcaagctgggcgaagtgctggaacagcaagccacccagtcg
gtggcggccagcagcgacggcgcccagcgcgaagaagtcgccgcgctgcgcacccgcatg
ctggaggcgatcaacaccatcaagacctccaagctggggcagaagtccggttcggccgcc
ctctacgagctgccctggtacatggtgatcggcaaccccgctgccggcaagagcaccgcc
atcgccaattccggattgcagttccccttcgccgacaagggcggcaagatcgtccacggc
gtgggcggcacccgcaactgcgactggttcttcaccaccgacggcatcctgctcgatacc
gccggccgctattcggtctatgaagaagaccgcaacgagtggttcagcttcctgggcctg
ctcaagcgctatcgcaagcaagcgccgatcaacggcatcatcatcgcggtcagcatcgcc
gaactgaccggcaaccgtcccgaattcgccatcaacctggccaagaacctgcgccagcgc
gtgcaggagctgactgaaaagctggaagtgttcgccccggtctatgtggtcttcaccaag
gccgacctgatcaccggcttcaatgaattcttcctcgacaccgaacgcagcgagcgtgac
cgcgtctggggcgctaccctcgcctacgaccgcaagcgcagcggccaggaagtggtcagc
ttcttcgatgaacgtttcgacgagctctacgccggcctcaaggagatgagcctggccagc
atgtcggtcaagcgcggtgaaaacatggccccgggcgtgctgaccttcccgctggagttt
tcctcgatcaagggcgtgctgcgctccttcgtggccacgctgttcgaagagaatcccttc
cagttcaagccggtcttccgcggcttctatttcaccagcgccgtgcaggaaggcgccacc
gtgagcgcctcttcgcaacgcatcgccgaccgcttcggactggcgctggaacacaagccg
caacgcgagatcttttcccagcacggcttcttcctgcacaacctgttcaagcaggtgatc
ttcgccgacaagcagctggtggcgcagtacaccagccgcaccaagatccgcatgcgctat
gccaccttcttcgccgccatcgccatcctgggcgtgctgctgggtggctggagctggtcc
tacatgggcaatcgccagctgctggccaatgtgcaggccgacatggacaaggccgtcaag
ctgcaggaaaaacgcctggacctgcaatcgcgcttcgaggcgctggaaatcctgcaggac
cgcatcgaacagctggaccgctaccgcgccagccgtcccatctcagtgggcatgggtctc
taccagggtgatctgctggaacgcaagctgcgcgaggaatacttctccggcatcaaggaa
atcatgttgaagccggtggccagcaacatcgagagctacctgatggaagtcaacgccaat
gccgcgcgcctggagccgatgtcgcgtccgccgcaatcgggcggcatcacgccagtggcc
gacaatggcgcgcaagccgccagcgcgctgcgcacctacaaggacagctcggccaccagc
gtcgaggatgcctataacgccctgaagacctatctgatgctggccgacaagtcgcgcgcc
gaatcgagccatctgaacgaccagatcacccgcttctggcgcggctggctggaaaccaac
cgtggcaccatgccgcgcgaacagatgatccgcagcgccgagcgcctcatcagtttctcg
ctggaacagatcaacgatccttcctggccgaccatcgacaacaagctgaccctggtggac
caggcccgcgaaaacctgcgccgcgtggtgcgcggcatgcccgcgcgcgaacgcgtgtac
gccgacgtcaaggcccgcgccgccacccgctttgcttccatgacggtagcgcgcatcgtc
ggcgacaaggaccgcgaactggtcatgggcagctatgccatccccggcaccttcacccgc
gacgcctgggagaaattcgtccaggaagccttcaaggaagccgccaacaaggaactgcag
agcgccgactgggtgctcaagacctcagccaaggatgacctgacgctggaaggcagcccc
gagcagatccagaaggccctggtgacgcagtacaagaccgaatatgcgcgcgaatggcag
aaattcctgcagggcgtgagcatcgtcgaactgcgcaacctggacgacgccaccaatgcc
atgaaccgcctgggcgatcccatcacctcgccgatgaagaaggtcatcaacaccgtctat
gacgagacctcctgggacaatccctcgctggtggacgccggcctggccaacgccaagagc
ggcttcatgggctggttcaaggaaaccatcctgcgccgctcccctgcccccgcgccgacc
cagttcaacgccgatggcacgaccgccatcccgatgggtccagtcggccgcgaattcagc
ggcgtggcgcgcctggtggtgagcaaggacaagaacggatcgctgctgcagacttatctg
gacaacctgtccaagctgcgcacccgcctcaacaccatcaagaaccagggcgataccggc
cccggcgccaagcagctgatgcagcagacgctggaaggcaacggttccgaactgtccgat
tcgctcaagttcgtcgacgaggaaatgctgcccggcctgaacgaccagcagaagaccgtg
ctgcgtccgctgctggtgcgtccgctggtgcagggcttcaacgccctggtgcggccgacc
gaaggcgaggtcaacaagatctggcgcgcccaggtgtacgaacccttccagagcaatctg
gcagccaagtacccgttctcgcccaattccaaaatcgaagccaacagcggcgagatcggc
accgtcttcggcgagaatggcgccatctccaagttcgtcaccacggccatgggtccgctg
gtggtgcgccgtggcgatacgctgtcgccgcgcaagtgggcggacatgggcattaacctg
tcaccggccattacgagcaacttcgccagctggatcagcgccccgggcggcggcggcgat
gccaatggcggcgccaacagcgcccagaccgtgttccagatccagccgcagcccgcgccc
ggtgccctggagtacaccatcgagatcgacggccagcaactgcgctaccgcaatacccag
gcgcagtggaccaacttcatctggcccaatccgcagggtacgccaggggcccgcgtgacg
gcccagacctacgacggccgcaccatcgaagtggccagccagcccggccgcttcggcctg
gagcgcctgatcaactcggcccagcgcaagcgcaaggacaacggcgtcttcgagctgtcc
tggaccaatgagggcgtcaccgtggtggtcaacctgaagatcatcagcagcgccgaagtc
tcaggcaccgccaacggccctgcccgcggcaccgccagcctgcgcggcctgaagctgccg
gagaccattgctgggggagcgcctgcgcccgtcctcgcccctgctcctgccggcgccgct
ggcactgcgccgatgcagccggggcagccgatggcgaccgacgctgcagccccccagtcc
aacaatcaaccaaccattacaggggtcaagcaatga

DBGET integrated database retrieval system