KEGG   Herbaspirillum seropedicae SmR1: Hsero_1740Help
Entry
Hsero_1740        CDS       T01268                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00564  Glycerophospholipid metabolism
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
Module
hse_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:hse00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hsero_1740 (psd)
Enzymes [BR:hse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Hsero_1740 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ADJ63253
UniProt: D8IQZ2
Position
1968784..1969428
Genome map
AA seq 214 aa AA seqDB search
MNNNHYPHPIIAREGWPFLTIAVVVAALATYFCGAWSFPLWIIALFVLQFFRDPPRVIPQ
AANAVLSPADGRIVVVARAHDPYTDREALKISVFMNVFNVHSNRAPVDGKIEKVQYFPGK
FVNADLDKASLENERNALAITTTSGHSVTCVQVAGLIARRILCYVKAGDTLARGQRYGFI
RFGSRVDVYLPLTATPKVTVGEKVSATETILAEL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaataaccactatccccaccccattatcgcccgcgaaggctggcccttcctgacc
atcgccgtggtcgtggcagcgctggcaacctatttctgcggcgcctggtccttcccgctg
tggatcatcgcgctgttcgtgctgcagttcttccgtgatccgccgcgcgtgatcccgcaa
gccgccaatgccgtgctgtccccggccgatggccgcatcgtcgtggtggcccgcgcccat
gatccctataccgaccgcgaagccctgaagatcagcgtcttcatgaacgtcttcaacgtc
cactccaaccgtgccccggtggatggcaagatcgagaaggtgcagtacttccccggcaag
ttcgtcaatgccgacctcgacaaggcctcgctggaaaacgagcgcaacgccctggccatc
accaccaccagcggccatagcgtgacctgcgtgcaggtggccggcctgatcgcccgccgc
atcctgtgctacgtcaaggccggcgatacgctggcgcgcggccagcgctacggtttcatc
cgcttcggttcgcgcgtggacgtgtacctgccgctgacggccacccccaaggtcaccgtg
ggcgaaaaggtctcggcgaccgaaaccattctggccgaactctga

DBGET integrated database retrieval system