KEGG   Herbaspirillum seropedicae SmR1: Hsero_2567Help
Entry
Hsero_2567        CDS       T01268                                 

Gene name
fadD
Definition
(GenBank) long-chain acyl-CoA synthetase protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00061  Fatty acid biosynthesis
hse00071  Fatty acid degradation
hse01100  Metabolic pathways
hse01212  Fatty acid metabolism
hse02024  Quorum sensing
Module
hse_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hse00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Hsero_2567 (fadD)
   00071 Fatty acid degradation
    Hsero_2567 (fadD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Hsero_2567 (fadD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hse01004]
    Hsero_2567 (fadD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hse04147]
    Hsero_2567 (fadD)
Enzymes [BR:hse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Hsero_2567 (fadD)
Lipid biosynthesis proteins [BR:hse01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Hsero_2567 (fadD)
Exosome [BR:hse04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Hsero_2567 (fadD)
  Exosomal proteins of breast cancer cells
   Hsero_2567 (fadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ADJ64066
UniProt: D8IWP6
Position
complement(2926488..2928449)
Genome map
AA seq 653 aa AA seqDB search
MVETRQDREAATFPRLLLAHARQRPERAAFREKDLGIWQTTSWRQVAEEVRSFACGLAAL
GFRRGMSLAIIGNNCPRLYWAMSAAQALGGMPVPLYQDAPAADMAYVLADANVDFVMAED
QEQVDKVFEIKESLPRIAHVIYDDERGMRNYHQPELLSFARVQELGRAYERAHPDFFDQE
IAAGSPDDVAIILYTSGTTGKPKGVCHSHRAMITTATTLVEFDHLDENDDILCYLPLAWV
GDFLYSFAQQHVAGFCLNCPESPNTVMTDLREIGPTYYFAPPRVYENILTQVMIRIEDAG
WLKRKMFHGFMKVARRVGMRILDGKPGVSLLDRLQYGLGSLLVYGPLKNVLGMSRLRVAY
TGGEAIGPDLFDFYRSLGINLKQLYGMTETCVTVCMQPSGDVKLDSVGRPMKGVEVRIDE
NGEVLVRSPGLMKEYFKRPDATAEAIDANGYFHTGDAGFFDSDGHLKIIDRAKDVGKMAS
GSMFAPKYIENKLKFFPFIKEAVTFGNGREQCMAFINIDMDAVGNWAERRNLAYSGYTDL
AANPAVYALLRECVEKVNADLAADPLLADSQIHRFLILHKELDPDDEELTRTRKVRRGFI
ADKYAVLIEALYAGRASQYIETQVKFEDGRQGMISADLKIAEAKTFKTLQSAA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggtggagacgagacaagacagggaggccgcgacctttccgcggctgttgctggcgcat
gcccgccaacgtcctgagcgggcagccttccgcgagaaggacctgggcatctggcagacc
acgagctggcgccaggtggccgaggaagtgcgcagcttcgcctgcggcctggcggcgctg
ggtttcaggcgcggcatgagcctggccatcatcggcaacaactgtccacgcctgtactgg
gccatgagcgccgcgcaggccctgggcggcatgcccgtgccgttgtaccaggatgcgccg
gcggctgacatggcctatgtgctggccgacgccaacgtcgacttcgtcatggccgaagac
caggagcaggtcgacaaggtcttcgagatcaaggaaagcctgccgcgcatcgcccacgtc
atctacgacgacgagcgcggcatgcgcaactaccaccagcccgagctgctctcctttgcc
cgcgtgcaggaactgggccgggcctacgagcgcgcacatccggatttcttcgaccaggaa
atcgccgccggctcgcccgacgacgtggccatcatcctctatacctccggcaccactggc
aagcccaagggcgtgtgccattcgcaccgggccatgatcaccaccgccaccacgctggtg
gagttcgatcatctcgatgagaacgacgacatcctctgctacctgccgctggcctgggtg
ggcgacttcctgtattcgttcgcgcagcagcatgtggccggcttctgcctgaactgcccg
gagtcgcccaacaccgtgatgacggacctgcgcgagatcggcccgacctattatttcgcg
ccgccgcgggtctacgaaaacatcctcacgcaagtgatgatccgtatcgaggacgccggc
tggctcaagcgcaagatgttccatggcttcatgaaggtggcgcgccgggttggcatgcgc
atcctcgatggcaagccgggcgtgtccctgctcgatcgcctgcaatatggactgggcagc
ttgctggtgtatggaccactgaagaacgtgctgggcatgtcgcgcctgcgcgtggcctat
acgggcggtgaggccatcgggccggacctgttcgacttctatcgttcgctgggcatcaat
ctcaagcagctctatggcatgaccgagacctgcgtgacggtctgcatgcagccctcgggc
gacgtcaagctcgatagcgtggggcggccgatgaagggcgtggaagtgcgcatcgacgaa
aacggcgaagtgctggtgcgctcgcctggactgatgaaggaatatttcaagcggcccgac
gccaccgccgaggccatcgatgccaatggctacttccacaccggcgacgccggcttcttc
gacagcgacggtcacctgaagatcatcgaccgcgccaaggatgtcggcaagatggccagc
ggcagcatgttcgcacccaagtacatcgagaacaagctcaagttcttccccttcatcaag
gaagccgtgaccttcggcaatggccgcgagcaatgcatggccttcatcaacatcgacatg
gatgcggtgggcaactgggccgaacggcgcaacctggcctatagcggctataccgacctg
gccgccaatcccgccgtctatgcgctgctgcgcgaatgcgtggagaaggtcaacgccgac
ctggccgccgatccgctgctggctgattcgcagatccatcgcttcctgatcctgcacaag
gagctcgatcccgacgatgaagaattgacccgcacccgcaaggtccggcgcggcttcatc
gccgacaagtacgcggtgctgatcgaagcgctctacgccgggcgtgcatcgcagtacatc
gagacccaggtcaagttcgaggatggccgccagggcatgatctcggccgacctcaagatc
gccgaggccaagaccttcaagacgctgcaaagcgccgcctga

DBGET integrated database retrieval system