KEGG   Herbaspirillum seropedicae SmR1: Hsero_2788Help
Entry
Hsero_2788        CDS       T01268                                 

Definition
(GenBank) carboxylesterase protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
hse  Herbaspirillum seropedicae SmR1
Brite
Enzymes [BR:hse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Hsero_2788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Abhydrolase_2 DUF676 Abhydrolase_3 BAAT_C
Motif
Other DBs
NCBI-ProteinID: ADJ64283
UniProt: D8IYU8
Position
3187457..3188368
Genome map
AA seq 303 aa AA seqDB search
MDTLSSTDHPGPVTPPPAEDRQGGPHKEHAVILLHGLCGSQLEMGSIPKQLKKAGCTVIP
LNIDNYSAALTNPRVSPNWEEWCAVVESRVARLKEEFRTVSLCGLSMGATLALAVAARSK
ELLSVVLLSPVLQYDGWSVPWYWKLLTVVYDLGFRNWSYKESEPYGIKNFEMRRRVASAL
EKDGVAAVGAASIPARHLRAALRMIDYVKQSLPLVRTDTLIIHSIDDETASPRNAEQILQ
YINAEVRKVVWLGDCYHIITVDNEREIVTNETVMFIRRSIEMHGHEFSRKHLAHASPLKD
RRG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggacactttgtcatccactgaccatccggggccagtcacaccgccccccgcagaagac
cgtcaaggcggcccgcacaaggaacatgccgtcatcctcttgcacggcttgtgcggctcg
caactggagatgggctcgattcccaagcagctcaagaaagccggctgtaccgtcattccc
ctcaatatcgacaattactcggcggcgctgaccaacccgcgtgtctccccgaactgggaa
gaatggtgcgccgtggtggaaagccgggtggcgcgcctgaaggaagaattccgcaccgtc
tccctgtgcgggctgtccatgggcgccaccctggccctggccgtggccgcccgcagcaag
gaactgctgtcggtggtgctgctctcgccggtgctgcaatacgacggctggtcggtgcct
tggtactggaagctgctgaccgtggtctacgacctgggctttcgcaattggtcctacaag
gaaagcgaaccctacggcatcaagaacttcgagatgcgccgccgcgtggccagcgccctg
gaaaaggatggcgtggccgccgtcggcgccgcctccatcccggcgcgccacctgcgcgca
gcgctgcgcatgatcgactacgtcaagcagtccctgccgctggtgcgcaccgataccctg
atcatccattccatcgacgacgagaccgcgtccccgcgcaatgccgaacagatcctgcag
tacatcaacgccgaagtgcgcaaggtggtctggctgggcgactgctatcacatcattacc
gtggacaacgaacgcgagatcgtgaccaatgagaccgtgatgttcatccggcgcagtatc
gagatgcatggtcacgaattctcacgcaagcacctggcgcatgcgtcacccctgaaggac
aggcgcggctga

DBGET integrated database retrieval system