KEGG   Herbaspirillum seropedicae SmR1: Hsero_2880
Entry
Hsero_2880        CDS       T01268                                 

Gene name
hlyD
Definition
(GenBank) hemolysin secretion-related transmembrane protein
  KO
K11003  hemolysin D
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Hsero_2880 (hlyD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hse02000]
    Hsero_2880 (hlyD)
   02044 Secretion system [BR:hse02044]
    Hsero_2880 (hlyD)
Transporters [BR:hse02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   Hsero_2880 (hlyD)
Secretion system [BR:hse02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Hsero_2880 (hlyD)
SSDB
Motif
Pfam: HlyD_3 HlyD HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl
Other DBs
NCBI-ProteinID: ADJ64372
UniProt: D8IZN2
Position
complement(3272530..3273873)
AA seq 447 aa
MSLRHRWQAWTDLWRRYLRVFGHAWRQRGHYRSDFFNKDEAEFLPAALSLQEAPDSRSLR
WTARLLVGMVIFALLWSLLGRIDIVVSANGKVIPSARTKTIASVDVSAVRAILVSEGQLV
KAGEVLIELDSSSSDAERDKAADAVAQARLQAARAQAMMEAIQNLRTPELAQVPGVAQAQ
WEAVRSQLVAQYQDFRARLGRLDDEISRYGAALKLATQRASDYQTLVADHTVSRHAWLEK
EQARVDLQGQLDDARNQRATLVAQTRKDAHDSRIEADKTIEASQQDQRRADEHSKLLKLV
APVTGTVQQLTVHTIGGVVPAAQPLMQIVPQDSQIEVEAMLENKDVGFVEIGQAAEVKID
AFDYTKYGTLPARVVHISRDAIQDEKKGLLYSARIVLDQSSLIVDGRKVQLSAGMAANVE
IKTGNRRVIEYALSPLIRHQKEALHER
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagcctgcgtcatcgttggcaagcctggacggatctgtggcggcgctacctgcgcgtg
tttggtcatgcctggagacagcgcggccactatcgcagcgatttcttcaacaaggacgaa
gccgaattcctgccggcggcgctgtccctgcaggaagctccggactcgcgcagcctgcgc
tggaccgcgcggctcttggtggggatggtgatctttgcgctgctctggtcgctgctgggg
cgcatcgatatcgtggtcagcgccaatggcaaggtgatcccctcggcgcgcaccaagacc
attgcctcggtggatgtgtcagcggtgcgcgccatcctggtcagcgaagggcagttggtc
aaggccggagaggtgctcatcgaactcgactccagcagcagcgacgccgagcgcgacaag
gctgccgacgcggtggcccaggcgcgtctgcaggccgcgcgggcgcaggccatgatggag
gccatccagaacctgcgtacgcccgagctggcgcaggtgccgggcgtggcgcaggcccaa
tgggaagcggtgcgcagccaactggtggcgcagtaccaggatttccgcgcccgccttgga
cggctcgatgacgagatcagccgctatggcgctgccttgaaactggcgacccagcgtgcc
agcgactaccagacgctggtggccgaccacaccgtgtcgcgccatgcctggctggagaag
gagcaggccagggtggacctgcaaggccagctcgacgacgcccgcaaccagcgcgccacc
ctggtggcgcagacccgcaaggatgcccacgacagccgcatcgaggctgacaagaccatc
gaggcatcgcaacaggaccagcgccgcgccgacgagcacagcaagctgctcaagctggtc
gcgccggtcacgggcaccgtgcagcaactcaccgtgcataccatcggcggggtcgtgccg
gcggcgcagccgctcatgcagatcgtgccgcaggatagccagatcgaagtcgaggccatg
ctggagaacaaggacgtgggctttgtcgagatcggtcaggcggccgaggtcaagatcgac
gccttcgactacaccaagtacggcaccctcccggccagggtggtccacatctcgcgcgac
gccatccaggatgaaaagaaaggcctgctctactcggcccgcatcgtgctggaccagagc
agcctcatcgtcgatgggcgcaaggtgcagctctcggccggcatggccgccaatgtggaa
atcaagacgggcaatcgccgggtcatcgaatatgcgctctcgccgctgatccggcaccag
aaggaggctctgcatgagcgatga

DBGET integrated database retrieval system