KEGG   Herbaspirillum seropedicae SmR1: Hsero_3281Help
Entry
Hsero_3281        CDS       T01268                                 

Definition
(GenBank) PHP family metal-dependent phosphoesterase protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
hse  Herbaspirillum seropedicae SmR1
Brite
KEGG Orthology (KO) [BR:hse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hsero_3281
Enzymes [BR:hse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Hsero_3281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ADJ64762
UniProt: D8J1X9
Position
complement(3758503..3759351)
Genome map
AA seq 282 aa AA seqDB search
MSMSELKFDLHCHSNVSDGLLPPEQVAARAKANGVGVWALTDHDEIDGVARARAAAQALG
MVHVGGVEISVTWAGHTVHIVGLQIDETNPALVQGLAATRNGRERRAREIAAQLEQHGVA
GAYEGALKHVGNPDLISRTHFARFMVECGRCCDTREVFANYLTEGKPGYVPHRWATLEEA
VRWIRGAGGVAVIAHPGRYKYSETQFGAFFDEFRQLGGAAIEVNTGSHTPEQYQQYAQVA
RHYGFLASMGSDFHGPGESRVDLGGLPPLPQGVKPVWHDWAL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgtctatgtctgagctcaagttcgatctgcattgccattccaacgtctccgacggcttg
ctgccgcccgagcaggtggcagcacgtgccaaggccaatggcgtgggagtgtgggccttg
accgaccacgatgagatcgatggcgtggcgcgcgcccgtgccgcggcccaggccctgggc
atggtgcatgtgggcggcgtagagatttcagtgacctgggctggccatacggtgcatatc
gtgggtctgcagatcgacgaaaccaatcctgcgctggtgcagggtctggccgccactcgc
aacggccgcgaacggcgcgcccgcgagatcgccgcgcagctggagcagcatggcgtggcg
ggggcctatgaaggcgcgctcaagcatgtgggcaacccggacctgatctcgcgcacccat
ttcgcccgcttcatggtcgagtgcggtcgctgctgcgatacccgggaagtcttcgccaac
taccttaccgaaggcaagcccggctacgtgccgcaccgctgggccacgctggaagaagcc
gtgcgctggatccgcggggccggcggggtggcggtgatcgcccacccgggccgctacaaa
tacagcgagacccagttcggcgccttcttcgacgaattcaggcagctcggcggcgcggcc
atcgaggtcaataccggcagccacacgccggagcagtaccagcaatacgcccaggtggcg
cgccattatggctttttggcctcgatggggtcggacttccacggtccaggcgaatcacgg
gtggacctgggcggcttgccgcccctgccccagggtgtcaagccggtctggcacgactgg
gcgctgtaa

DBGET integrated database retrieval system