KEGG   Herbaspirillum seropedicae SmR1: Hsero_3292Help
Entry
Hsero_3292        CDS       T01268                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase (beta chain) protein
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00260  Glycine, serine and threonine metabolism
hse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01130  Biosynthesis of antibiotics
hse01230  Biosynthesis of amino acids
Module
hse_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hsero_3292 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hsero_3292 (trpB)
Enzymes [BR:hse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hsero_3292 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP THUMP ComFB
Motif
Other DBs
NCBI-ProteinID: ADJ64773
UniProt: D8J1Z0
Position
complement(3770564..3771823)
Genome map
AA seq 419 aa AA seqDB search
MKELNPLGGFAERQAIPAAALHQTAHYNLPDSRGHFGPYGGSFVSETLTLALNELREAYA
RYQHDEQFLAEFHTELKHFVGRPSPVYHAKRWSEMAGGAQIYFKREDLNHTGAHKINNVI
GQALLAKRMGKKRIIAETGAGQHGVATATICARFGMECIVYMGSEDVKRQLQNVYRMNLL
GAKVVPVESGSKTLKDALNEAMRDWVTNVETTFYIIGTVAGPHPYPMMVRDFQSVIGNEC
IQQMPEIASRQPDYVVAAVGGGSNAMGIFYPYIDYPDVKLVGVEAAGDGLDTGRHSASLT
LGSPGVLHGNRTYLLQDANGQIIETHSVSAGLDYPGVGPEHAWLKDSGRASYACITDDEA
LEAFNTCCRIEGIIPALESSHALAHAAKLAATLPRDQIVLVNLSGRGDKDMHTVQQRQG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattgaatcccctcggcggtttcgccgagcgtcaagccattcctgccgccgcc
ctgcaccagacggcccactacaacctgcccgattcccgcggccatttcggcccgtacggc
ggcagcttcgtgtccgaaacgctgaccctggccttgaacgagctgcgcgaggcctatgcg
cgttaccagcacgatgagcagttcctggccgaattccataccgaactgaagcatttcgtc
ggtcgtcccagcccggtgtaccacgccaagcgctggtccgagatggcgggtggcgcgcag
atctacttcaagcgcgaagacctgaaccacaccggcgcccacaagatcaacaacgtgatc
ggccaggcgctcttggccaagcgcatgggcaagaagcgcatcatcgccgagaccggcgcc
ggccagcacggcgtggccacggccaccatctgcgcgcgcttcggcatggaatgcatcgtc
tacatgggcagtgaagacgtgaagcgccaattgcagaacgtctaccgcatgaacctcttg
ggcgccaaggtggtgccggtggagtccggttccaagaccctgaaggatgcgctcaatgaa
gccatgcgcgactgggtcaccaatgtcgagaccaccttctacatcatcggcaccgtggcc
ggtccgcacccctatccgatgatggtgcgcgacttccagtcagtgatcggcaacgagtgc
atccagcagatgccggaaatcgcctcgcgccagcccgactacgtggtggcggcggtgggt
ggtggttccaacgccatgggcatcttctatccctacatcgactacccggacgtcaagctg
gtcggcgtggaagccgccggcgatggcctggacactggccgtcactcggcctcgctgacc
ctgggctcgcccggcgtgctgcacggcaaccgtacctacctgctgcaggacgccaacggc
cagatcatcgagacccactcggtctcggccggcctggactatccgggcgtgggcccggaa
cacgcctggctcaaggacagcggtcgcgccagctatgcctgcatcaccgatgacgaggcg
ctcgaagccttcaatacctgctgccgcatcgaaggcatcatccccgcgctggagtccagc
cacgcactggcccatgcggccaagctggcggccaccttgccgcgggaccagatcgtgctg
gtcaacctgtccggccggggggacaaggacatgcataccgtgcaacagcgccagggttga

DBGET integrated database retrieval system