KEGG   Herbaspirillum seropedicae SmR1: Hsero_3889Help
Entry
Hsero_3889        CDS       T01268                                 

Gene name
apaG
Definition
(GenBank) Mg2+/Co2+ transport regulator of protein
  KO
K06195  ApaG protein
Organism
hse  Herbaspirillum seropedicae SmR1
Brite
KEGG Orthology (KO) [BR:hse00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Hsero_3889 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ADJ65362
UniProt: D8IS19
Position
complement(4451725..4452099)
Genome map
AA seq 124 aa AA seqDB search
MAAYEFTVTVKTQYLEEQSDPSRSHYVFAYAITIVNTGTVPAQLISRHWVITDANNHVEE
VRGLGVVGHQPFLQPGEQFEYTSGTSLKTPQGSMHGEYFCVAEDGEQFDVRIPEFVLSLP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtatgagttcacggtgacggtcaagacccagtacctggaggagcaatccgat
ccatcgcgttcgcattacgtgttcgcctatgcgatcaccatcgtcaataccggcaccgtg
ccggcgcagctcatttcgcgccactgggtcatcaccgacgccaacaaccacgtcgaggaa
gtgcgcgggctgggcgtggtgggacatcaacccttcctgcagccgggcgaacagttcgaa
tacaccagcggcacctcgctcaagacgccccagggcagcatgcacggcgaatacttctgc
gtggccgaggatggcgaacagttcgacgtgcgcattcccgaattcgtcctctcgctgccg
cgcaccctgcactga

DBGET integrated database retrieval system