KEGG   Herbaspirillum seropedicae SmR1: Hsero_3918Help
Entry
Hsero_3918        CDS       T01268                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase protein
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00900  Terpenoid backbone biosynthesis
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hsero_3918 (ipk)
Enzymes [BR:hse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Hsero_3918 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADJ65391
UniProt: D8IS48
Position
4482962..4483831
Genome map
AA seq 289 aa AA seqDB search
MTTILTACPAPAKLNLFLHVTGRRPDGYHLLQSAFQLIDRCDTLDFAVRDDGRIIRTNEV
LGVPAESDLVIRAAHLLRDAAGRPELGADITVHKVLPMGGGVGGGSSDAATTLLVLNHLW
KCGYNRASLMEMGLKLGADVPFFLFGRNAFAEGVGEELSVLRTADCWYVVIEPGVSVPTS
IIFSSKLLTRDTQPVRITDFPDATKQVASSFGKNDLEMVATAHFPEVAAAVEWLGKFGNA
RMTGSGACVFCAFEHEHQADEVLKTLPSRWIGWKAKAMQEHPLAHLVQS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcctcaccgcctgcccggcgccggccaagctgaacctgttcctgcatgtg
accggccgccgtccggatggctatcatctgctgcaatcagccttccagctcatcgaccgc
tgcgacaccctggacttcgcggtacgcgacgatggacgcatcatcaggaccaacgaagtg
ctgggcgtgcccgccgagtccgacctggtgatccgcgccgcgcatctcctgcgcgacgcc
gcaggccgcccggagctgggggccgacatcaccgtgcacaaggtcctgcccatgggcggt
ggagtcggcggcggctcttccgatgcggcgacgaccttattggtcttgaatcatttatgg
aaatgcggctacaatcgcgcctcgctgatggagatgggcctcaagctcggcgctgatgtt
cccttcttcctgttcggccgcaatgcattcgcagaaggtgtgggcgaagagttgtcggtg
ctgcgtaccgcggattgctggtatgtggtgatcgaaccgggcgtatctgttccaacctcg
ataattttttcttcaaagttgttgacaagggatacgcaacccgtcagaataacggacttt
cctgatgcgacgaaacaagttgcttccagcttcgggaaaaacgatctggaaatggtggca
accgcgcatttccccgaagttgcagcagcagtcgaatggctgggcaaattcgggaatgca
agaatgaccggatctggcgcctgtgtgttttgtgcattcgaacacgaacatcaggcagac
gaagtgctcaagacattgccttcgcgctggatcggctggaaagccaaagcgatgcaggaa
catcctctcgcccatttagtgcagtcgtaa

DBGET integrated database retrieval system