KEGG   Herbaspirillum seropedicae SmR1: Hsero_4008Help
Entry
Hsero_4008        CDS       T01268                                 

Gene name
paaJ
Definition
(GenBank) acetyl-CoA acetyltransferase (thiolase) protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00071  Fatty acid degradation
hse00072  Synthesis and degradation of ketone bodies
hse00280  Valine, leucine and isoleucine degradation
hse00310  Lysine degradation
hse00362  Benzoate degradation
hse00380  Tryptophan metabolism
hse00620  Pyruvate metabolism
hse00630  Glyoxylate and dicarboxylate metabolism
hse00640  Propanoate metabolism
hse00650  Butanoate metabolism
hse00900  Terpenoid backbone biosynthesis
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
hse01200  Carbon metabolism
hse01212  Fatty acid metabolism
hse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hsero_4008 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    Hsero_4008 (paaJ)
   00640 Propanoate metabolism
    Hsero_4008 (paaJ)
   00650 Butanoate metabolism
    Hsero_4008 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hsero_4008 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    Hsero_4008 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hsero_4008 (paaJ)
   00310 Lysine degradation
    Hsero_4008 (paaJ)
   00380 Tryptophan metabolism
    Hsero_4008 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hsero_4008 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hsero_4008 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Hsero_4008 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hse04147]
    Hsero_4008 (paaJ)
Enzymes [BR:hse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hsero_4008 (paaJ)
Exosome [BR:hse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hsero_4008 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF4358
Motif
Other DBs
NCBI-ProteinID: ADJ65479
UniProt: D8ISR3
Position
4597086..4598339
Genome map
AA seq 417 aa AA seqDB search
MAQAAFYSSFKDIWLVGGVRTPMVDYCTSFSQLSPTDMGIKVAREVLARTGIDPADIGSV
VAGNMAPGDAYQYMLPRHIGLYAGVPISTPAIMVQRICGTGFELIRQAGDQIERGYTEAA
LIVGSESMTRNPIAAFGHRSGFKLGAPVEFQDYMWEALVDPAPGITMPQTAENLAKKYGI
TRAEVDEYAAYSFERALKAQAAGFHAGEIVPVVNETFRLDGYNDRHIKLQGKLSEAAADT
HPRPSPVEVLAKLRTLYPDGVQTGGNSSALVDAAAATIVASGDYVRRNDKAPLARVVAAA
VAGVPPEIMGIGPVPAIRTLLERNGLTVADIGCFEINEAQGAQIVAVERELGIDRERLNV
NGGAIALGHPLAATGVRLSITAAREMNRRGARYCVASACIGGGQGIALLLENPSASH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagcagcgttctactccagcttcaaggacatctggctcgtcggcggcgtgcgc
acgcccatggtggattactgcaccagcttcagccagctctcgcccaccgacatgggcatc
aaggtggcgcgtgaggtattggcgcgcactggcatcgacccggctgacatcggctcggtg
gtggccggcaacatggcccccggcgacgcctaccagtacatgctgccgcgtcacatcggc
ttgtatgccggggtgccgatcagcacgccggccatcatggtccagcgcatctgcggcacc
ggcttcgaactgatccgccaggccggcgaccagatcgagcgcggctataccgaggcggcg
ctgatcgtgggcagcgaatcgatgacgcgcaatcccattgccgccttcggtcatcgtagc
ggctttaagctgggtgcaccggtggaattccaggactacatgtgggaagcgctggtcgat
ccggcccccggcatcaccatgccgcagacggctgagaacctggcgaagaagtacggcatc
acccgcgccgaggtcgatgaatacgcggcctattccttcgagcgcgccctgaaggcgcaa
gcggcgggcttccacgcgggcgagatcgtgccggtggtcaacgagaccttccgcctcgac
ggctacaacgaccgccacatcaagctgcagggcaagctcagcgaggccgccgccgatacc
catccgcgcccctccccggtggaagtgctggccaagctgcgcacgctctatccggatggc
gtgcagaccggcggcaacagctcggcgctggtggatgcggcggccgccactatcgtcgct
tccggcgattacgtacgccgcaacgacaaggcgccgttggcccgtgtggtcgcagcggcg
gtcgcgggcgtgccgccggagatcatgggcatcggcccggtgccggccatccgcaccctg
ctggaacgcaacggcctgacggtggccgacatcggctgcttcgagatcaacgaagcgcaa
ggcgcacagatcgtggcggtggaacgtgagctgggcatcgatcgcgaacgcctcaacgtc
aacggcggcgccattgccctgggtcatccgctggcggcgaccggcgtgcgcctgtcgatc
accgccgcgcgcgagatgaatcgccggggtgcgcgctattgcgtggcgtcggcttgcatc
ggcggcggccagggcattgcgctgctgctggaaaatccctcggcttcccactga

DBGET integrated database retrieval system