KEGG   Herbaspirillum seropedicae SmR1: Hsero_4033
Entry
Hsero_4033        CDS       T01268                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
hse  Herbaspirillum seropedicae SmR1
Brite
KEGG Orthology (KO) [BR:hse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hse02044]
    Hsero_4033
Secretion system [BR:hse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Hsero_4033
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ADJ65504
UniProt: D8IST8
Position
complement(4630000..4631844)
AA seq 614 aa
MQELLPYYERELSFLRRYSRDFSERYPKIAGSLLMAGEICEDPHIERMIQSYALLNARVS
KRLDDDYPQFTEALFEVLYPHYLRPFPSCSIARMDCAESAEQLTSATIIPRGTTLSTRPV
KGVVCQFQTVYDVPVAPICLTHAVFSPIIDAPEAVVLPTSVTSSLSIGIATAGEQLALAK
LDLVSLRVFIDGEASFCAALRDSLFMRSAAAWIELPGSRRWVPLPAIPLAEVGFADEDAL
IDFPSQSHPAYRHLTEYFAFPEKFNFFDIDLSAILAVLPADSKSFILHLGLSGLRADSHI
ARQLGGVSAANLLLGCTPVINLFSQRGDPIRLTHAGAYYPVLPDGRRAFGYEVYSIDSVQ
LVRETPQGESITSFRPFYSLRHGQSPESDGHYWAMRRDELIALKSPGYETEISIVDIDFD
PSKIETDTLSIELTCTNRDLPALLAYGLPGGDLSLEGGGVIRTAALLRKPTLPSRFERGR
GAQWRLISQLSLNHLSLMRVGLEAFQEMLTLYDQSNSPISQRQISAIAAIDHRPATAWLP
GNPFASLVRGIEVKLTVDEEGFVGSGLHAFAGVIDRFMGLYVHANSFSQLTVISKRTGEE
LLKCRPRSGDLSLA
NT seq 1845 nt   +upstreamnt  +downstreamnt
gtgcaagagcttctgccatattacgagcgcgagctgagctttctgcgccgctactcccgg
gatttctccgagcgttacccaaagattgcgggcagcttgctgatggctggcgagatctgt
gaggatcctcatatcgagcgcatgatccagtcctatgcgttgctcaatgcacgtgtctcc
aagcgtttggatgatgattacccgcagttcaccgaggccttgttcgaggtcctttatccg
cattatcttcgtcccttcccgtcctgttcgatcgcccgcatggattgcgcggaatcggcg
gaacaactgaccagtgccaccatcatccctagaggtacgacgttatctacccgaccggtc
aagggcgtggtttgccagtttcagacagtttatgatgtcccggtcgctcctatctgtctg
acgcacgcggtcttctcgccgatcattgacgcacccgaagcagtggtattgccgacttcg
gtgacgtcctccctctccatcggcatcgcaacggcgggggagcagctggccttggccaag
ctcgacctggtctcgctgcgcgtttttatagatggcgaggcatctttctgcgccgccctg
cgagacagcttatttatgcgcagcgctgccgcctggatcgagttgccgggcagtcggcgt
tgggttcccttgcccgcgatccctttggctgaggtcggattcgccgatgaggatgcgttg
atcgattttccttcacagtctcatccggcatatcgccatctgaccgagtattttgccttc
cccgaaaaattcaatttctttgatattgacctgtcggccatccttgcggtcctgcctgcg
gacagcaaaagtttcatcctgcacctgggactttccggtctgcgggccgattctcatatt
gccaggcagcttgggggagttagtgccgccaatttgctgttgggttgcacaccagtgatc
aatctgttcagccaacgcggcgatccaatccggctgacgcatgctggtgcttactatcca
gtattacccgatggccggcgagccttcggttacgaggtgtattcgattgattcggtgcaa
ctagtacgggagacgccgcagggcgagtccatcacaagctttcgccccttctactcgctg
cgtcatggccaatcgcccgagagtgatggtcattactgggccatgcgccgtgacgaactg
attgcattgaagagtcctggctatgaaaccgagatatccatcgttgatatcgatttcgat
ccctccaagattgagaccgatactttaagcatcgaactgacttgcaccaaccgggatctt
cctgccttgctggcctatggcctgcctggcggtgatctgagcctggagggcggcggcgtg
atccgtaccgctgccctgctgcgcaagccgacattgccatcccgcttcgagcgagggcgc
ggggcccaatggcggttgatttcgcaactgtcgctgaatcatctttccctcatgcgcgtc
ggcctcgaggccttccaggaaatgctgacgctctatgatcagtccaattcacctatctca
caacggcagatcagtgccattgctgccattgaccatcgacctgcaaccgcatggctgcct
gggaatccgtttgccagccttgtccgcggaatagaggtcaagctgaccgttgatgaggaa
ggtttcgtgggaagtggattgcacgccttcgcgggcgtgatcgatcgcttcatgggcttg
tacgtgcacgccaacagcttttcgcagctgaccgtgatatccaaaagaaccggagaggaa
ttgctcaaatgcaggccacgcagcggagatttgagcctagcgtga

DBGET integrated database retrieval system