KEGG   Herbaspirillum seropedicae SmR1: Hsero_4069Help
Entry
Hsero_4069        CDS       T01268                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase oxidoreductase protein
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00340  Histidine metabolism
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Hsero_4069 (hisD)
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Hsero_4069 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADJ65539
UniProt: D8ITA9
Position
complement(4662025..4663341)
Genome map
AA seq 438 aa AA seqDB search
MSIAIRKLDSADAGFRDQLSAVLAFEASEDEAIDRAAATILADVKARGDAAVLEYTQRFD
RLQAASVAALEIGKDALQAALAGLPEARRHALQTAADRVRAYHERQKKECGSDGFLYREA
DGTELGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAKVAGVQEVIMVVPTPDGVKNELV
LAAAAIAGVDRVFTIGGAQAVGALAYGTATIPQVDKIVGPGNAYVAAAKRRVFGVVGIDM
IAGPSEILVICDGATDPDWIAMDLFSQAEHDELAQSILLCPDADYIAKVEASINRLLDDM
PRKDVIRTSLTDRGALVKVRDMAEACEIANMIAAEHLEISAQEAQQWADQIRHAGAMFLG
RFSSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSIIRVSEEGAQTLGKIAAELA
YGEGLQAHARSAELRLKK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgccatccgaaaactcgattccgccgatgctggcttccgcgaccagctctcg
gccgtgctggccttcgaagccagcgaagacgaggccatcgaccgcgccgcggccaccatc
ctggccgatgtgaaggcgcgcggcgacgccgccgtgctggaatacacccagcgcttcgac
cgcctgcaggccgcttccgtggcggcgctggagatcggcaaggacgcgctgcaagccgcg
ctggccggcctgcccgaggcgcgtcgtcatgcgctgcagaccgccgccgaccgcgtgcgc
gcctatcacgagcgccagaagaaggaatgcggctccgatggcttcctctatcgcgaagcc
gatggcaccgagctgggccagaaggtcacgccgctggaccgcgtgggcatctacgtgccc
ggcggcaaggcggcctatccgtcgtcggtgctgatgaatgcgattccggccaaggtggct
ggcgtgcaggaagtcatcatggtggtgcccacgcccgatggcgtgaagaatgagttggtg
ctggccgccgccgccattgccggggtggaccgcgtcttcaccatcggtggtgcgcaggct
gtgggcgcattggcctatggcaccgcgaccattccgcaggtggacaagatcgtcggcccc
ggcaatgcctatgtggccgcggccaagcgccgcgtgttcggcgtggtcggcatcgacatg
atcgccggtccctccgagatcctggtgatctgcgacggtgccaccgatcccgactggatc
gccatggacctgttctcgcaagccgagcacgatgaactggcgcaatccatcctgctgtgc
ccggatgcggactacatcgccaaggtcgaggcgtcgatcaaccgcctgctggacgacatg
ccgcgcaaggacgtgatccgcacctcgctgaccgaccgtggtgcgctggtcaaggtgcgc
gacatggccgaagcctgcgagatcgccaacatgatcgccgccgaacacctggagatttcc
gcgcaggaggcgcagcagtgggccgaccagatccgtcacgctggcgcgatgttcctgggc
cgtttctcgtccgaatcgctgggggattattgcgctggtcccaatcacgtattgccgacc
tcgcgcacggcacgcttctcctcgccgctgggcgtgtatgacttccagaagcgctccagc
atcatccgcgtatcggaagagggcgcccagacgctgggcaagatcgccgctgaactggcc
tatggcgaaggcttgcaggcgcacgcccgctcggccgaattgcggctgaagaagtaa

DBGET integrated database retrieval system