KEGG   Herbaspirillum seropedicae SmR1: Hsero_4225Help
Entry
Hsero_4225        CDS       T01268                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase protein
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00020  Citrate cycle (TCA cycle)
hse00620  Pyruvate metabolism
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
hse01200  Carbon metabolism
Module
hse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hsero_4225 (mqo)
   00620 Pyruvate metabolism
    Hsero_4225 (mqo)
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Hsero_4225 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: ADJ65694
UniProt: D8IUG2
Position
complement(4832515..4834164)
Genome map
AA seq 549 aa AA seqDB search
MLKKTFLALLGFVVALATAPASQAADVKKVDVLLVGGGIMSTTLAVWLNELEPGWSMEMI
ERLDGVAEESSNGWNNAGTGHSALAELNYTPEDKDGKIQIAKAIEINEAFQISRQFWSWQ
VKSGVLKNPRSFINTTPHMSFIWGDDNVTYLKKRYQALQASPLFAGMQYSEDHEQIKKWV
PLMMEGRDPQQKLAATWTPLGTDVNFGEITRQFAAYLQARPNFALKLSSEVRDITRNADG
TWRIGYKNLKDGSTTETDAKFVFIGAGGGALKLLQKSGIPEARDYAAFPVGGSFLITDNP
AIAERHLAKAYGKASVGAPPMSVPHLDTRVLDGKRVILFGPFATFSTKFLKQGSLWDLFS
ATTTHNVWPMARVGIDEYPLVEYLAGQLMLSDDERFAALKEYFPNAKKEDWRLWQAGQRV
QIIKRDDVKGGVLKLGTEIVASADGSMAGLLGASPGASTAAPIMLSVLQKVFKDKLATPE
WQQKVRQIVPSYGTKLNDHPDQVAKEWAYTSEVLQLAPPPVIAPKATGKDAAKGSMEKPK
ANASADMAL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaaaccttcctggccttgctgggattcgtagttgcgctggccaccgcgcca
gcctcgcaggcggccgacgtcaagaaggtcgacgtgctgctggtcggcggcggcatcatg
agcaccaccctggccgtctggctcaatgagctggaaccgggctggtcgatggaaatgatc
gaacgcctcgatggcgtggccgaagaaagctccaatggctggaacaacgccggcaccggc
cactccgccctggccgagttgaactacacccccgaagacaaggatggcaagatccagatc
gccaaggccatcgagatcaacgaagccttccagatctcgcgccagttctggtcgtggcag
gtcaagagcggcgtgctgaagaacccgcgttccttcatcaacaccaccccgcacatgagc
ttcatctggggcgatgacaacgtcacctacctgaagaagcgctaccaagccctgcaggcc
agcccgctgttcgccggcatgcagtattcggaagaccacgagcagatcaagaagtgggtg
ccgctgatgatggaaggccgcgacccacagcagaagctggccgccacctggaccccgctg
ggcaccgacgtcaacttcggcgagatcacccgccagttcgccgcctacctgcaagctcgt
cccaacttcgcgctcaagctctccagcgaagtgcgcgacatcacccgcaacgctgacggc
acctggcgcatcggctacaagaacctcaaggatggcagcaccaccgagaccgacgccaag
ttcgtcttcatcggcgcgggcggcggcgccctcaagctgctgcagaagtccggcatcccc
gaggcgcgcgactacgcggccttcccggtcggcggttccttcctgatcaccgacaacccc
gccatcgccgagcgccacctggccaaggcctatggcaaggcctccgtgggcgcgccgccg
atgtcggtgccgcacctcgacacccgcgtgctggacggcaagcgcgtgatcctgttcggc
cccttcgcgaccttctcgaccaagttcctcaagcaaggctcgctgtgggacctgttctcg
gccaccaccacccataacgtctggccgatggcccgcgtcggtatcgatgaatacccgctg
gtggaataccttgccggccagctgatgctgtccgacgacgagcgcttcgcggccctgaag
gaatacttccccaatgccaagaaggaagactggcgcctgtggcaagccggccagcgcgtg
cagatcatcaagcgtgacgacgtcaagggtggcgtgctgaagctgggcaccgagatcgtt
gcctccgccgatggcagcatggctggcctgctgggtgcctcgccgggcgcgtcgacggct
gcgcccatcatgctgtcggtgctgcagaaggtcttcaaggacaagctggccacacccgaa
tggcagcagaaggtgcgccagatcgttcccagctatggcaccaagctcaatgaccatcct
gaccaggtcgccaaggaatgggcctataccagcgaagtgctgcaactggccccgccgccg
gtgatcgcacccaaggcgaccggcaaggacgccgccaagggcagcatggaaaagcccaag
gccaacgcatcagccgatatggcgctgtaa

DBGET integrated database retrieval system