KEGG   Halanaeroarchaeum sulfurireducens M27-SA2: HLASA_0110Help
Entry
HLASA_0110        CDS       T04261                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hsf  Halanaeroarchaeum sulfurireducens M27-SA2
Brite
KEGG Orthology (KO) [BR:hsf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HLASA_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ALG81026
UniProt: A0A0F7PAE6
Position
complement(108674..109846)
Genome map
AA seq 390 aa AA seqDB search
MTGAGLATIVVAAAASLFTAWVIGAGSSGSTPFAPAVGANAISVMRAGFYVGILGFAGAV
LQGANVSEAIGAELIHGVSLSPLAATVALTTGATLVAIGVFTGYPIATAFTITGAVVGVG
LAMGGDPAWAKYRQIATLWVGVPFVGGGIAFGTARTLRDTDRVRLTVPALAALVGIVLAN
VRFELLGPAESSRSIAGAAAHAVAGGNPLVGAGAGVAFALAIGGIVRWDLARSVEGAQRR
FLVALGSLVAFSAGGSQVGLAVGPLLPLLGDTVPLEFVLVGGGIGLLVGSWTSAPRMIKA
VSQDYSSLGPNRSIAALIPSFVIAQTAVFFGIPISFNEVVVSAIVGSGLAVGSSGVSRQK
MGYTVLAWVGSLAISLVVGYGAYLTAIRLL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtgctggtctcgcgacgatcgtggtcgctgccgcggcgagcctgttcacggcc
tgggtcatcggcgcgggctcctcggggtcgacgccgttcgctccggccgtcggcgcgaac
gcgatctcggtgatgcgggcggggttttacgtgggtatcctcggtttcgcgggcgccgtc
ctccagggagcgaacgtctcggaggcgatcggcgcggagttgatccacggcgtatcgctg
tcgccgctcgcggcgacggtcgcgctgacgaccggcgcgacgctggtcgcaatcggcgtc
ttcacgggctaccccatcgccacggcgttcacgatcacgggcgccgtcgtcggcgtcggg
ctggcgatgggtggcgatccggcgtgggcgaagtaccgccagatcgcgaccctctgggtc
ggtgtccccttcgtcggcggcggcattgccttcggaacggcacggactctacgagacacc
gaccgggtgcggctaacggtgcccgcactcgcggccctcgtgggaatcgtcctggcgaac
gtccggttcgaactcctggggccggcggaatcctcgcgttccatcgccggggcggccgcc
cacgccgtggccggcggtaatccgctcgtcggggcgggcgccggcgtcgcgttcgcgctc
gcaatcggtggcatcgttcggtgggatctcgccaggagcgtcgagggtgcccaacggcgg
ttcctggtcgcactcggatcgctcgtcgcgttctccgccggtgggagccaggtcggcctg
gccgtcgggccactcttgccgctcctgggcgacaccgtgccgctcgagttcgtcctcgtg
ggcgggggaatcggtctcctcgtcggttcgtggaccagcgcgccgcggatgataaaggcc
gtctcgcaggactactcctccctggggccaaaccgttccatcgccgcgctcatcccgtcg
ttcgtcatcgcccagacggcggtcttcttcggtatcccgatctcgttcaacgaggtggtc
gtgagcgcgatcgtgggcagcggcctcgccgtcggctccagcggggtcagccggcagaag
atgggatacaccgttctggcctgggtgggatcgctcgcgatctcgctcgtggtcgggtac
ggcgcctacctgaccgccatccggttactctag

DBGET integrated database retrieval system