KEGG   Halanaeroarchaeum sulfurireducens M27-SA2: HLASA_0575Help
Entry
HLASA_0575        CDS       T04261                                 

Definition
(GenBank) hypothetical protein
  KO
K09722  4-phosphopantoate---beta-alanine ligase [EC:6.3.2.36]
Organism
hsf  Halanaeroarchaeum sulfurireducens M27-SA2
Pathway
hsf00410  beta-Alanine metabolism
hsf00770  Pantothenate and CoA biosynthesis
hsf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HLASA_0575
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HLASA_0575
Enzymes [BR:hsf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.36  4-phosphopantoate---beta-alanine ligase
     HLASA_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPS_PS RTT107_BRCT_6
Motif
Other DBs
NCBI-ProteinID: ALG81476
UniProt: A0A0N9N2U8
Position
complement(558765..559517)
Genome map
AA seq 250 aa AA seqDB search
MTEDIPSDHPRHDSLVTRHRIEAGVDAGITSRQGLIAEGRGEAFDYLLGEETIPSADDAE
RAAAAQLLLAEHPVLSVNGNAAALVPEELVELAETVGADLEVNLFKRTPARMEAIADHLQ
AHGAPDVKGLDADERIPGIDHERARVDADGIYDADVVLVPLEDGDRAEALAEMGKVEIVI
DLNPLSRSPRTAAIPVIDNIIRAIPNITAHARSLESAERDELEAIVADFDAERALHEAEE
RIRTGAGQEQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggacattccctccgaccaccctcgccacgactcgctggtgactcgccaccgg
atcgaggcgggcgtggacgccggcattacgagcagacaggggctcatcgccgaggggcgg
ggcgaagcgttcgattacctgctgggcgaggagacgatcccgagcgccgacgacgccgag
cgggcggccgccgcccagttgctgcttgccgagcaccccgtcctctcggtaaacggcaac
gcggccgccctcgtgcccgaggaactggtcgaactcgccgagacggttggtgcggacctc
gaggtcaacctgttcaaaagaacgccggcacgaatggaggccatcgccgaccacctgcaa
gcccacggcgcgcccgacgtgaagggcctcgatgccgacgaacggatcccagggatcgat
cacgagcgtgccagggtcgacgccgacggcatctacgacgccgacgtcgttctcgtgccc
ctcgaggacggcgaccgggcggaggcgctggccgagatgggcaaagtggagatcgtcatc
gacctgaaccccctgtcccgatccccgcgcacggcggcgatccccgtcatcgacaacatc
atccgggcgatcccgaacatcacggcccacgcccgatcgctcgaatccgccgagcgggac
gaactcgaggcgatcgtcgcggacttcgacgccgaacgcgcgttacacgaggccgaagaa
cggatccgcacgggcgccggccaggaacagtga

DBGET integrated database retrieval system