KEGG   Halomonas aestuarii: BOX17_08110Help
Entry
BOX17_08110       CDS       T04554                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
hsi  Halomonas aestuarii
Pathway
hsi00270  Cysteine and methionine metabolism
hsi00480  Glutathione metabolism
hsi01100  Metabolic pathways
Module
hsi_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BOX17_08110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BOX17_08110
Enzymes [BR:hsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BOX17_08110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: APE30921
UniProt: A0A1J0VFX7
Position
1782573..1783538
Genome map
AA seq 321 aa AA seqDB search
MSDRPLKVGVVMDPIADLTYKKDTSLAMLWAAQDRGWSLHYLEQQDLFLREGRAFGRMRR
LDVHRDPGHWFDLGEPEAEPLATLDVILMRKDPPVDGHFLNAVYLLGFAEREGVLVVNPT
QALLECNEKLFAQQFPHCCTPTVVSCDERVLRDFHAEHGDVIFKPLDGMGGSGIFHVRPE
GRNLGSIIEMLSDRGQRQIMAQRYIPEISEGDTRILLVDGEPVPYGLARVPMAGETRGNL
AAGGTGVSRELTARDHWLIEQVQPVIREKGLMFVGLDVIGDYITEINVTSPTCVREIDDQ
RGTDIAGLLMDAIERRLGEQG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgccccttgaaggtcggcgtggtgatggatcccatcgccgacctcacctac
aagaaggacaccagcctggccatgctgtgggccgcccaggatcgtggctggtcgctgcac
tacctggagcagcaagacctcttcctgcgcgaggggcgcgccttcggtcggatgcgccgc
ctcgacgtgcatcgcgaccccgggcactggttcgacctgggcgagcccgaggcggagccc
ctggcgacgctcgacgtcatcctgatgcgcaaggatcccccggtcgacggccacttcctc
aatgccgtctacctgctgggcttcgccgagcgcgagggcgtgctggtggtcaaccccacc
caggcgctgctggagtgcaacgagaagctcttcgcccagcagttcccccactgctgcacc
cccaccgtggtctcctgcgacgagcgcgtgctgcgggatttccatgccgagcacggcgac
gtgatcttcaagccgctggacggcatgggcggcagcgggatcttccacgtgcgccccgag
ggccgcaacctcgggtccatcatcgagatgctgagcgatcgcgggcagcgccagatcatg
gcccagcgctacatccccgagatctccgagggcgacacccggatcctgctggtggacggc
gagccggtgccctacggcctcgcccgggtgcccatggccggtgagacccgcggcaacctg
gccgccggcggcacgggggtcagccgcgagctcaccgcccgcgaccactggctgatcgag
caggtacagccggtgatccgcgagaaggggctgatgttcgtcggcctcgacgtgatcggt
gactacatcaccgagatcaacgtgaccagccccacctgcgtgcgcgagatcgatgaccag
cgcggcaccgacatcgccggcctgctgatggatgccatcgagcgtcggctcggcgagcag
ggctga

DBGET integrated database retrieval system