KEGG   Halomonas aestuarii: BOX17_08890Help
Entry
BOX17_08890       CDS       T04554                                 

Definition
(GenBank) hypothetical protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
hsi  Halomonas aestuarii
Pathway
hsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BOX17_08890
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BOX17_08890
Enzymes [BR:hsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BOX17_08890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Redoxin
Motif
Other DBs
NCBI-ProteinID: APE31056
UniProt: A0A1J0VGA7
Position
1942219..1943544
Genome map
AA seq 441 aa AA seqDB search
MSLTGFQTTADDPLMHRCEPGEAPDGHEEHPGIRLNPAVRYQRYLGTGGAFTEAAAINYS
RLDEAEKARFLEGYFSPDDGHGYSLCRLPMNSCDFSLGNWACQPSPDAPFSLARYREHLF
PMLREAEATLGRPIDLLVSPWSPPAWMKTSGEMNHGGRLRQECRAQWAQSFVQFVQALRE
EGFSVWGVTVQNEPEAAQAWDSCLYSATEERDFIRQHLGPALAEAGLGEVRIVCWDHNRD
NLYERAQTILGDPESARFVWGAGYHWYMEECFDNVQAVHDAFPDKGLLFTEGCQEGGPHS
GEWAVAERYARSMIHDLRRWCQGWIDWNLALDTSGGPNHVDNLCSAPALVDPRQGRFEWQ
PSFHALGHVARFVPPGSVRILSAAATDRLDHVAFAREDGTCVLVVLNASEAAVDWSLRLG
EAAHAVTTPPHALQTWVLSGR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttacaggattccagaccaccgcggatgatccgctgatgcaccgctgcgagccc
ggcgaggcgccggacgggcacgaggagcaccccggcattcgcctgaacccggcggtgcgc
tatcagcgctacctcggcacgggcggggcctttaccgaggcggcggcgatcaactattcg
cggctcgatgaggccgagaaggcccgattcctcgagggctacttctcgccggatgacggc
cacggctactccctgtgccggctccccatgaacagctgcgacttcagcctgggcaactgg
gcctgccagccctcgccggacgcgccgttctccctggcgcgctatcgggagcacctcttc
ccgatgctccgcgaggccgaggcgaccctggggcgccccatcgacctgctggtgtcgccc
tggagtccgcccgcctggatgaagaccagcggcgagatgaaccacgggggccggctgcgg
caggagtgccgggctcagtgggcgcagtccttcgtgcagttcgttcaggcgctgcgcgag
gaggggttctcggtgtggggcgtgaccgtgcagaacgaacccgaggcggcccaggcctgg
gactcctgcctgtactcggccacggaagagcgagacttcatccgccagcacctggggccg
gcgctcgccgaggccgggctcggcgaggtgcgcatcgtctgctgggatcacaatcgcgac
aatctgtatgagcgggcgcagacgatcctcggcgaccccgagtccgcccgcttcgtctgg
ggggctggctaccactggtacatggaggagtgcttcgacaacgtccaggccgtgcatgac
gccttccccgacaaggggctgctgttcaccgaggggtgccaggagggcgggccgcattcc
ggcgagtgggctgtggccgagcgctatgcccggtcgatgatccatgacctgcgccgctgg
tgtcagggctggatcgactggaacctggcgctggacacctcgggcggacccaatcacgtc
gacaacctctgttcggcccccgcgctggtggatccccggcaggggcggttcgagtggcag
ccgtccttccacgccctgggccacgtcgcgcgcttcgtgccgcccggcagcgtgaggatc
ctctcggccgccgcgacggatcgtctcgaccacgtggccttcgcgcgggaggacggcacc
tgcgtgctggtggtgctgaatgccagcgaggcggcggtcgactggtcgctgcgcctcggc
gaggccgcccatgccgtgacgaccccgccccatgcgctgcagacctgggtgttgtccggc
agatga

DBGET integrated database retrieval system