KEGG   Halomonas aestuarii: BOX17_09825Help
Entry
BOX17_09825       CDS       T04554                                 

Definition
(GenBank) bifunctional 4'-phosphopantothenoylcysteine decarboxylase/phosphopantothenoylcysteine synthetase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
hsi  Halomonas aestuarii
Pathway
hsi00770  Pantothenate and CoA biosynthesis
hsi01100  Metabolic pathways
Module
hsi_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BOX17_09825
Enzymes [BR:hsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     BOX17_09825
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     BOX17_09825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: APE31220
UniProt: A0A1J0VGQ5
Position
complement(2123211..2124521)
Genome map
AA seq 436 aa AA seqDB search
MSSLPGPDNSGRPNAGRRILLGISAGIAAYKSAQLARLLKQAGCEVRVVMTEGAQAFITP
LTLQALTGEPVRTSLLDPEAEAGMGHIELARWADTILIAPATADLMARLAQGLADDLLTT
LCLASEAEKVMAPAMNQAMWRHPATRRNADRLVEDGWRLLGPASGDQACGDVGPGRMLEP
EAILAALLPGAPGAAPSSMASHDTPVESQASREADGLTVTITAGPTREPLDPVRYLSNHS
SGKMGYALAAAAASLGARVRLISGPVALATPPGVERIDVETAREMHEAAQRLARDSDLFI
GCAAVADYRAETAAEHKIKKADGEEGLTLRLVKNPDIIAAVAALAERPFVVGFAAETRDL
EAYARDKLTRKGLDMIVANDVSSPEIGFGTDHNAALLLWRDGDAEARESLAPQPKARLAL
AVMQRALACLPSRRTP
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactgcccggcccagacaacagcggccgcccgaacgcgggccgccgcatcctg
ctcggcatcagcgccgggatcgccgcctacaagagcgcccagctcgcccgtctgctcaag
caggccggctgcgaggtgcgcgtggtcatgaccgagggcgcccaggccttcatcaccccg
ctgacgctgcaggcgctgaccggcgagcccgtgcgcacctcgctgctcgaccccgaggca
gaggccggcatggggcacatcgagctcgcccgctgggccgacaccatcctgatcgccccg
gccaccgccgacctgatggcgcgcctcgcccagggcctcgccgacgacctgctgaccacc
ctgtgcctggccagcgaggccgagaaggtgatggccccggccatgaaccaggccatgtgg
cgccatcccgccactcggcgcaatgccgaccgcctcgtcgaggacggctggcggctgctg
ggaccggccagcggcgaccaggcctgcggcgacgtgggcccgggtcgcatgctggagccc
gaggcgatcctggcggcgctgctgcccggggcgcccggtgccgcgccctcctccatggcg
tcccacgacacgccggtcgagtcgcaagcgtcgcgggaggccgacggcctgaccgtgacc
atcaccgccggccccacccgggagccgctggacccggtgcgctacctctccaaccacagc
tccggcaagatgggctatgccctggccgccgccgccgcctcgctcggggcccgggtgcgg
ctcatcagcggcccggtggccctggccaccccgccgggcgtcgagcgcatcgatgtggag
accgcccgggagatgcacgaggccgcccagcggctggcccgcgacagcgacctcttcatc
ggctgcgccgccgtcgccgactaccgcgccgagacggccgccgagcacaagatcaagaag
gccgacggcgaggagggactcaccctgcgcctggtgaagaaccccgacatcattgccgcg
gtggcggccctggcggaacgccccttcgtggtgggattcgccgccgagacccgcgacctc
gaggcctatgcccgggacaagctgacccgcaaggggctggacatgatcgtcgccaacgac
gtctcgagccccgagatcggcttcggcaccgatcacaatgccgccctgctgctgtggcgg
gacggcgacgccgaggcccgcgagagcctggccccccagcccaaggcccggctcgccctg
gcggtgatgcagcgcgccctggcctgcctgccgtcacgccgcaccccctga

DBGET integrated database retrieval system