KEGG   Halomonas aestuarii: BOX17_10135Help
Entry
BOX17_10135       CDS       T04554                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
hsi  Halomonas aestuarii
Pathway
hsi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BOX17_10135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsi01007]
    BOX17_10135
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsi03016]
    BOX17_10135
   03029 Mitochondrial biogenesis [BR:hsi03029]
    BOX17_10135
Enzymes [BR:hsi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BOX17_10135
Amino acid related enzymes [BR:hsi01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BOX17_10135
Transfer RNA biogenesis [BR:hsi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BOX17_10135
 Prokaryotic type
   Other AARSs
    BOX17_10135
Mitochondrial biogenesis [BR:hsi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BOX17_10135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APE31275
UniProt: A0A1J0VGW4
Position
complement(2190234..2191919)
Genome map
AA seq 561 aa AA seqDB search
MKETIIALLEGALDHLRQQGVLPADLAPAIKVEPTRDKAHGDYATNLALMLAKPAGRKPR
ELAETLVAALPESDAVQKVEIAGPGFVNFFAATDAAAQVVRQVLDAGDAFGRNLTGQGRQ
VQVEFVSANPTGPLHVGHGRGAAIGDSICRLLEATGHDVTREFYYNDAGAQITNLARSVQ
ARVQGIDPGDEGWPEDGYRGGYIIDVANAYLAGETVHADDRHVTAAGDPDDLEAIRDFAV
AYLRREQDLDLKAFGVEFDVYFLESSLYEQGKVEATVKRLIEKGHTYEQDGALWLRTTDF
GDDKDRVMRKSDGQYTYFLPDVAYHLDKWERGFATVINEQGADHHSTVTRVRAGLQALEA
GIPAGWPDYVLHQMVMVTRSGVEVKLSKRAGSYVTVRDLIDEVGRDATRFFLAARRADSQ
LTFDIDLARSQSNDNPVYYVQYAHARVCSMLRKAEAEDRAFDHALAMSQLALLDSDQEKA
VLNRLARYPEVVQHAAEAHEPQQIAQYLLDLAADFHTCYNAVKVMVDDDAQRNARLALGL
ATRQVLRNGLDLMGVGAPEEM
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaccatcatcgcgctgctcgagggcgccctggaccacctccggcagcagggc
gtcctgcccgccgacctcgcccccgccatcaaggtcgagccgacccgggacaaggctcac
ggcgactacgccaccaacctcgcgctgatgctggcgaagccggccggaaggaagccccgc
gagctggcagagacgctggtcgcggcactgccggagagtgacgccgtgcagaaggtggag
atcgcgggccccggcttcgtcaacttcttcgccgccaccgacgccgccgcccaggtggtc
cgccaggtgctcgacgccggcgatgccttcggccgaaacctgaccggccagggccggcag
gtgcaggtggagttcgtctccgccaaccccaccgggccgctgcacgtcggccatggccgc
ggggcggcgatcggggacagcatctgccggctgctggaggccaccggccatgacgtgacc
cgcgagttctactacaacgacgccggcgcccagatcaccaacctggcgcggtcggtccag
gcccgggtccagggcatcgaccccggcgacgagggctggcccgaggacggctaccgcggc
ggctacatcatcgacgtggccaacgcctacctggccggcgagaccgtccacgccgacgac
cgccacgtcacggccgcgggcgacccggacgacctcgaggccatccgcgacttcgccgtg
gcctacctgcgccgcgaacaggaccttgacctcaaggccttcggcgtcgagttcgacgtc
tatttccttgagtcctcgctctacgagcagggcaaggtcgaggccacggtcaagcggctg
atcgagaagggccatacctacgagcaggacggcgccctgtggctgcgcaccaccgacttc
ggcgacgacaaggaccgggtgatgcgcaagagcgacggccagtacacctacttcctgccc
gatgtcgcctaccacctcgacaagtgggagcgcggcttcgcgacggtaatcaacgagcag
ggcgccgaccaccactccaccgtgacccgggtgcgcgccgggctccaggccctggaggcc
ggcatcccggcaggctggcccgactacgtgctgcatcagatggtgatggtcacccgctcc
ggggtcgaggtgaagctctccaagcgtgccggcagctacgtcacggtgcgcgacctgatc
gacgaggtgggtcgcgacgccacccgcttcttcctggccgcccggcgcgccgactcccag
ctcaccttcgacatcgacctggcccgctcccagtccaacgacaatccggtctactacgtg
cagtacgcccacgcccgggtctgcagcatgctgcgcaaggccgaggccgaggaccgggcc
ttcgaccatgccctggccatgtcgcagctcgccctgctcgacagcgaccaggagaaggcg
gtgctcaaccgcctggcccgctacccggaagtggtccagcatgccgccgaggctcacgag
ccgcagcagatcgcccagtacctgctcgacctcgccgccgacttccatacctgctacaac
gcggtgaaggtgatggtcgacgacgacgcccagcgcaacgcccgcttggcgctgggcctg
gccacccgccaggtgctgcgcaacggcctcgacctgatgggtgtcggcgcgcccgaggag
atgtaa

DBGET integrated database retrieval system