KEGG   Halomonas aestuarii: BOX17_11425Help
Entry
BOX17_11425       CDS       T04554                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
hsi  Halomonas aestuarii
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BOX17_11425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: APE31502
UniProt: A0A1J0VHL1
Position
2475985..2476383
Genome map
AA seq 132 aa AA seqDB search
MTLTAPEGLDSDIRVDVAPDFRLDESDPDEQRFVFSYTVTVHNGSDHSVQLLARYWKITQ
GSGKVQEVRGKGVVGQQPLIAPGQTFRYTSRAILDGPVGVMEGAYTCVDTASQRPFEVAI
PPFRLAGPNQVH
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgacggccccggaagggctcgacagcgatatccgcgtcgacgtggcgccggac
tttcgcctggacgagtccgaccccgacgagcagcgcttcgtcttcagctataccgtcacc
gtgcacaacggctccgaccacagcgtccagctgctcgcccgctactggaagatcacccaa
ggcagcggcaaggtgcaggaggtgcgcggcaagggggtggtgggccagcagccgctgatc
gcccccggccagaccttccgctacaccagccgcgcgatcctcgacggcccggtgggggtg
atggagggcgcctacacctgcgtcgacaccgccagccagcgccccttcgaggtggccatc
ccgcccttccggctggccgggcccaaccaggtgcactag

DBGET integrated database retrieval system