KEGG   Halomonas aestuarii: BOX17_13505Help
Entry
BOX17_13505       CDS       T04554                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hsi  Halomonas aestuarii
Pathway
hsi00071  Fatty acid degradation
hsi00072  Synthesis and degradation of ketone bodies
hsi00280  Valine, leucine and isoleucine degradation
hsi00310  Lysine degradation
hsi00362  Benzoate degradation
hsi00380  Tryptophan metabolism
hsi00620  Pyruvate metabolism
hsi00630  Glyoxylate and dicarboxylate metabolism
hsi00640  Propanoate metabolism
hsi00650  Butanoate metabolism
hsi00900  Terpenoid backbone biosynthesis
hsi01100  Metabolic pathways
hsi01110  Biosynthesis of secondary metabolites
hsi01120  Microbial metabolism in diverse environments
hsi01130  Biosynthesis of antibiotics
hsi01200  Carbon metabolism
hsi01212  Fatty acid metabolism
hsi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BOX17_13505
   00630 Glyoxylate and dicarboxylate metabolism
    BOX17_13505
   00640 Propanoate metabolism
    BOX17_13505
   00650 Butanoate metabolism
    BOX17_13505
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BOX17_13505
   00072 Synthesis and degradation of ketone bodies
    BOX17_13505
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BOX17_13505
   00310 Lysine degradation
    BOX17_13505
   00380 Tryptophan metabolism
    BOX17_13505
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BOX17_13505
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BOX17_13505
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BOX17_13505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsi04147]
    BOX17_13505
Enzymes [BR:hsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BOX17_13505
Exosome [BR:hsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BOX17_13505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APE31878
UniProt: A0A1J0VIP5
Position
complement(2936529..2937716)
Genome map
AA seq 395 aa AA seqDB search
MSQSTDIVFLSATRTPMGGMLGSLSSLSAPELGATAIRAAIQRAGIDADCIDEGIMGCVL
PAGVKQGPARQAMRQAGIPDAIGATTINKLCGSGMKATMLAHDLIRAGTGEVMLAGGMES
MSNAPHVLTRARTGYRLGHGELKDHMFLDGLEDAETGKLMGVFAQEVASQRDYGRERLDD
FAIASLERAMEATRAGHLDAEMAPVTVTSRQGESVVDHDEQPFQAKLDKIRSLRPAFAKD
GTITAANSSSISDGASALILSSQAAADRLGARPIARMLGHSTHSRHPSEFTIAPVGAIEK
LMKKLDWGVNDVDLFEINEAFAVVTLMAMDDLGLPHDKVNVFGGACAQGHPIGSTGSRII
ATLIHALRTKGGRRGIASLCIGGGEATAVAVELVD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtccaccgatatcgtcttcctgtctgccacccgcacgcccatggggggcatg
ctcggcagtctctccagcctctccgcgccggagctcggcgccacggccatccgcgccgcc
atccagcgtgccggcatcgatgccgactgcatcgacgagggcatcatgggctgcgtgctg
cccgccggcgtcaagcagggaccggcccgccaggccatgcgccaggccggcatccccgat
gccatcggcgccaccaccatcaacaagctgtgcggctcgggcatgaaggccaccatgctg
gcccacgacctgatccgcgccggcaccggcgaggtgatgctggccgggggcatggagtcc
atgtccaacgcgccccacgtactcaccagggcccgcaccggctaccgcctgggccacggg
gaactgaaggatcacatgttcctggacggcctcgaggacgccgagaccggcaagctgatg
ggcgtcttcgcccaggaggtcgccagccagcgcgactacggccgagagcgcctggacgac
ttcgccatcgcctccctggaacgggccatggaagcgaccagggccggccacctggatgcc
gagatggcgccggtcaccgtcaccagccgccagggcgagagcgtggtggaccatgacgag
cagcccttccaggccaagctcgacaagatccgctcgctgcgtccggccttcgccaaggac
ggcaccatcaccgcggccaactccagctcgatctccgacggcgcctcggcgctgatcctg
tccagccaggcggcggccgaccggctcggcgcccggcccatcgcccggatgctcggccac
agcacccactcgcgccatcccagcgagttcaccatcgccccggtgggcgccatcgagaag
ctgatgaagaagctcgactggggcgtgaacgacgtcgacctcttcgagatcaacgaggcc
ttcgcggtggtcaccctgatggccatggacgacctgggcctgccccacgacaaggtcaac
gtcttcggcggcgcctgcgcccagggccatcccatcggctccaccggctcgcggatcatt
gcgaccctgatccacgccctgcgcaccaagggcggcaggcgcggcatcgcgagcctgtgc
atcggcggcggcgaggcgaccgccgtggccgtggaactggtcgattga

DBGET integrated database retrieval system