KEGG   Halobacterium salinarum: OE_1209FHelp
Entry
OE_1209F          CDS       T00662                                 

Definition
(GenBank) GalE family epimerase/dehydratase
  KO
K19243  NAD+ dependent glucose-6-phosphate dehydrogenase [EC:1.1.1.388]
Organism
hsl  Halobacterium salinarum
Pathway
hsl00030  Pentose phosphate pathway
hsl01100  Metabolic pathways
hsl01110  Biosynthesis of secondary metabolites
hsl01120  Microbial metabolism in diverse environments
hsl01130  Biosynthesis of antibiotics
hsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OE_1209F
Enzymes [BR:hsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.388  glucose-6-phosphate dehydrogenase (NAD+)
     OE_1209F
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-ProteinID: CAP13007
UniProt: B0R2Q0
Position
107292..108059
Genome map
AA seq 255 aa AA seqDB search
MDEPVLLTGASGRVGQAILGGIGDDYTWRLFDREPPTDDPDHEFVVADITDETAVREAAS
DVGAIVHLAGDPRPEAPWESVLRNNIDGTRTVLDAALAAGVDRVVFASSNHAVGHYETDR
KPDLYRSDDDFRLDGTERPRPGNLYGVSKAAGETLGRYYHDEHGLTFAAVRIGNLTAGHP
PIDYERGQAMWLSPRDCAHLIDRCLSADYDYEVVYGISDNDRKYYSLARAKDALGYEPRD
NSAEWDGDEKLSGGS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggacgagccggtcctcctcacgggcgcttccgggcgcgtcgggcaagccatcctcggc
ggcatcggcgacgactacacgtggcggctgttcgaccgcgagccgcccaccgacgacccc
gaccacgagttcgtggtggccgacatcaccgacgaaacagcggtgcgtgaggccgccagc
gacgtgggcgcgatcgtccacctggccggcgacccccgccccgaagccccctgggagagc
gtgttgcggaacaacatcgacggcacgcggacggtcctcgacgccgccctggccgctggt
gtcgaccgcgtcgtgttcgcgtcctcgaaccacgccgtcggccactacgagacggaccgc
aaacccgacctctaccgcagcgacgacgacttccggttggacggcaccgaacgcccccgt
ccggggaacctctacggcgtctcgaaggccgccggcgaaacgctcggccggtattaccac
gacgagcacggcctcacgttcgccgccgttcgcatcggcaacctcaccgcgggccacccg
cccatcgactacgagcgcggccaagcgatgtggctgtccccccgggactgcgcgcacctc
attgatcgctgtctcagcgcggactacgactacgaggtggtctacggcatctcggacaac
gaccgcaaatactactcgctggcgcgtgccaaagacgcgctcggctacgagccccgtgac
aactccgccgagtgggacggcgacgagaaactctccggcggcagctga

DBGET integrated database retrieval system