KEGG   Histophilus somni 2336: HSM_0159
Entry
HSM_0159          CDS       T00673                                 

Definition
(GenBank) ferredoxin, 2Fe-2S type, ISC system
  KO
K04755  ferredoxin, 2Fe-2S
Organism
hsm  Histophilus somni 2336
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    HSM_0159
SSDB
Motif
Pfam: Fer2
Other DBs
NCBI-ProteinID: ACA31351
UniProt: B0UVM0
Position
170352..170693
AA seq 113 aa
MPKIVFLPHQDFCPEGMVVDAAPGENLLDVAHNAGVEIHHACDGSCACTTCHVVIREGFD
SLNETTEQEEDMLDKAWGLEMDSRLSCQCVVGEEDLVVEIPRYNLNHANEAAH
NT seq 342 nt   +upstreamnt  +downstreamnt
atgcccaaaattgtttttttacctcatcaagatttttgtcccgaaggaatggttgttgat
gctgcaccgggagaaaatctattagacgttgcacataatgcaggcgtggaaattcatcat
gcctgtgatggctcttgtgcttgtaccacttgccatgttgttattcgagagggatttgac
agtttaaatgagacaacagaacaagaagaagatatgttagataaggcttggggcttagaa
atggatagccgtctttcttgtcaatgtgtggtcggagaggaagatcttgtagtagaaatt
ccacgttataatttgaatcatgctaatgaagcggctcattga

DBGET integrated database retrieval system