KEGG   Haemophilus somnus 2336: HSM_0351Help
Entry
HSM_0351          CDS       T00673                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hsm  Haemophilus somnus 2336
Pathway
hsm00260  Glycine, serine and threonine metabolism
hsm00750  Vitamin B6 metabolism
hsm01100  Metabolic pathways
hsm01110  Biosynthesis of secondary metabolites
hsm01120  Microbial metabolism in diverse environments
hsm01230  Biosynthesis of amino acids
Module
hsm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HSM_0351
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HSM_0351
Enzymes [BR:hsm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HSM_0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACA31987
UniProt: B0UWP7
Position
389252..390529
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEQQVSFSQAVRQGLGKDQGLFFPEKLPHFDDIDSLLSLPLVERSQKILTAL
IGAELSQETISAMVKNAFTFPAPMVKVEDNIYALELFHGPTLAFKDFGGRFMAQALAVVR
GDSKITILTATSGDTGAAVAHAFYGLENIEVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NGDFDACQALVKQAFDDEELRQAVGLNSANSINISRLLAQVCYYFEAVAQLPKEIRQDIV
ISVPSGNFGNLTAGLIAKTLGLPIKRFIAATNANDTVPRYLNSGKWQPHTTVATLSNAMD
VSQPNNWPRVEELFKYNGWSLSELGSGALSDEETEKTLRAQYAKGYLCEPHGAIAYQVLK
DQLQVNETGIFLCTAHPAKFKENVERILSLELVLPETLDRYNKLPLLSDEMENDFAQLRA
YLLKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatataatattaaacatccggaacaacaagtaagtttttcacaagctgtgcgt
caaggtttaggaaaagatcagggcttattttttcctgaaaaattaccgcactttgacgac
attgatagccttttatctttgcctttggttgaacgcagtcaaaagattttaactgcttta
attggtgcggaattgtcacaagaaactattagtgcaatggtaaaaaatgcctttacattt
ccggcaccgatggtcaaagtagaagataatatctatgccttagaattgttccacggtccc
acgttagcttttaaagactttggaggacgttttatggcacaagccttagcggttgtgcgt
ggcgacagtaaaattactattttaactgctacttctggcgataccggtgctgcggttgca
catgctttctatggcttagaaaatattgaggtagtgattttatatccaaaaggtaaaata
agtccgttacaagaaaaattattttgtacacttggcgggaatattcgaactgttgcgata
aacggtgattttgatgcttgtcaagcattggtgaaacaagcctttgatgatgaagaactt
cgtcaagctgttggtttaaactctgcgaattcgattaatatcagtcgcttgttggcacaa
gtttgttattattttgaggcggttgcacagttaccgaaagaaatccgtcaagacattgtt
atttctgtgccgagcggtaatttcggtaacttaacagcgggattaattgccaaaacttta
ggcttaccaatcaaacgctttattgcggcaaccaatgccaatgataccgttcctcgctat
ttgaatagcggaaaatggcagcctcatacaacggttgcgactctttccaatgcaatggat
gtgagccaaccgaataactggcctcgtgtagaagaattatttaaatataacggctggtct
ttaagtgaattgggttcaggtgcattgagtgatgaagaaacagaaaaaaccttgcgggca
caatatgccaaaggttatttatgcgaaccgcatggggctattgcgtatcaggtgctaaaa
gatcaattacaggttaatgaaacgggtattttcctttgtacggcacatccggcaaaattc
aaggaaaacgttgagcgtattttaagtctcgagcttgtgcttccggaaacattggatagg
tacaacaagttgccattgctttctgatgaaatggaaaatgacttcgctcaattacgtgct
tatttattaaaaaaataa

DBGET integrated database retrieval system