KEGG   Histophilus somni 2336: HSM_0467Help
Entry
HSM_0467          CDS       T00673                                 

Definition
(GenBank) leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
hsm  Histophilus somni 2336
Pathway
hsm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HSM_0467
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsm01007]
    HSM_0467
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsm03016]
    HSM_0467
   03029 Mitochondrial biogenesis [BR:hsm03029]
    HSM_0467
Enzymes [BR:hsm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     HSM_0467
Amino acid related enzymes [BR:hsm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HSM_0467
Transfer RNA biogenesis [BR:hsm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HSM_0467
 Prokaryotic type
    HSM_0467
Mitochondrial biogenesis [BR:hsm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HSM_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ACA32112
UniProt: B0URM9
Position
542393..544975
Genome map
AA seq 860 aa AA seqDB search
MQEQYRPDLIEADVQKYWAEKKTFKAVKDPFKEKYYCLSMFPYPSGRLHMGHVRNYTIGD
VISRYQRMNGKNVLQPMGWDAFGLPAEGAAIKNKTAPAKWTYENIEYMKNQLKVLGFGFD
WDREITTCKPEYYKWEQWFFTELYKKGLVYKKTSTVNWCPNDETVLANEQVHEGGCWRCD
TPVEQKEIPQWFIKITDYAEQLLSDLDQLPEWPDMVKTMQRNWIGRSEGVEITFNVAHSD
QTLTVYTTRPDTFYGVSYLAVAAAHPLAENAAKNNPELAAFIHEAKNTKVAEAELATMEK
KGMATGLYAVHPMTGKQLPIWVANFVLMHYGTGAVMAVPAHDQRDYEFAQKYQLPLFPVI
KPADNSAWDFSKQAYTEHGITINSAEFDGLDFEATFNGIADKLEKIGVGKRQVNYRLRDW
GVSRQRYWGAPIPMLTLENGDVVVAPLQDLPIVLPEDVVMDGVKSPIKADPEWAKTTYNG
QVALKETDTFDTFMESSWYYARYTSPQYQQAMLDADETNYWLPVDQYIGGIEHATMHLLY
FRFFHKLLRDAGFVTSDEPSKKLLCQGMVLADAFYYTSPTNERIWVSPTKVTLERDEKGR
IIKAVDDEGHELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQE
SGVEGANRFLRRLWNLVFEYNQNPAQTALDPTALSVEQKALRREVHKTIAKVSDDIGRRQ
TFNTAIAAIMELMNKLTKASLSNEQDRAVMAEALNAVVRMLYPITPHICFQLWQDLGNES
AIDFAPWVIADAEAMVEDEKLVVIQVNGKVRAKVTVPADMSEDEIKQVALAEENVQKFLN
GLTVVKTIYVPGKLFSFVAK
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaacaatatcgtcctgatcttatcgaagcagacgtacagaaatattgggctgaa
aagaaaacattcaaagccgttaaagatcctttcaaagaaaaatattattgtctttccatg
tttccttatccttccggtcgtttacacatggggcatgttcgtaactataccattggcgat
gttatctcccgttatcaacgaatgaacggtaaaaatgttttacagcctatgggctgggat
gcttttgggttgccagcagaaggtgcggcaattaaaaataaaaccgcaccggcaaaatgg
acttatgaaaatatcgaatacatgaaaaatcagcttaaagtgttgggcttcggatttgat
tgggatcgtgaaattaccacttgtaaacctgaatattataaatgggagcaatggtttttt
actgagttgtacaaaaaaggattggtttataaaaaaacctcaacagtaaactggtgtccg
aatgatgaaaccgttttagcaaatgagcaagtacatgaggggggttgttggcgttgcgat
acccctgtggagcaaaaagaaattccgcaatggtttattaaaattacggactatgctgaa
caattattaagtgatttagatcagcttcctgaatggccggatatggtaaaaactatgcaa
cgtaactggataggtcgctccgaaggggttgaaattacctttaacgttgctcattcagat
caaaccttaacagtttatacaactcgtccggatactttctatggtgtttcttatttagcg
gttgcagcggcacatccgttagctgaaaatgcggcaaaaaataatcctgaattggctgct
tttattcacgaggcaaaaaataccaaagtggctgaagcggaacttgctacaatggagaaa
aaaggcatggcaacaggattgtatgcagttcatccgatgacaggtaaacagttaccgatt
tgggtagcaaattttgtgttaatgcactacggtacaggtgcggttatggcagttcctgca
catgatcaacgtgattatgaatttgcacaaaaatatcaattgcctttattccccgtgatt
aagccggcggataattctgcatgggatttttcaaaacaggcttatactgagcatggtatc
accattaattctgctgagtttgacggtttggattttgaggcaacctttaacggtattgcg
gataaacttgaaaaaatcggtgtaggaaaacgccaagtaaactatcgtttacgtgactgg
ggagtttcccgtcaacgttattggggagcaccaattccaatgctgacactggaaaatggt
gatgttgtagttgccccattacaggacttaccaattgttttgccggaagatgtagtcatg
gacggagtaaaaagtccgattaaggctgatcctgaatgggcaaaaaccacttataacgga
caagtagcattaaaagaaacggatacctttgatactttcatggaatcttcttggtactat
gcacgctatacctctccacaatatcaacaagcgatgttagatgcagatgaaacgaattat
tggctaccggtggatcaatatattggtggcattgaacatgcaaccatgcacctattatat
ttccgtttctttcacaaattgttgcgagatgccggtttcgtaacttctgatgagccaagc
aaaaaattactgtgtcaaggtatggtacttgcagacgcattttattacaccagcccaacc
aatgagcgtatttgggtatcgccgacaaaagtaacgttagagcgtgatgagaaaggtcgt
attatcaaagctgttgatgatgaaggtcacgagcttgttcacagcggtatgaccaaaatg
tctaagtccaaaaataatggtattgatccgcaagaaatggtggagaaatacggtgcagat
acagtccgtttatttatgatgtttgcttcaccggcagaaatgacacttgaatggcaagag
tcaggagtagagggggcaaatcgtttcttacgccgcctatggaatttagtttttgaatac
aatcaaaatccggcacaaaccgcattagatcctaccgctctttcagtcgaacaaaaagca
ttgcgtcgtgaggtacataaaactattgcaaaagtgagcgatgatattggtcgtcgccaa
acattcaataccgcaattgcggcaatcatggaattaatgaataaactcaccaaagcatca
ttatccaatgagcaagatcgtgcagtaatggcggaagcattgaatgccgttgtgcgtatg
ctttatccgattacaccacatatttgtttccaactttggcaagacttaggtaacgaaagt
gcgattgattttgcaccttgggtgatagccgatgctgaagctatggttgaagatgaaaaa
ttggttgtgatacaagtgaatggtaaagttcgtgctaaagtaaccgttcctgctgatatg
tcggaagatgaaattaaacaagttgctttagcagaagaaaatgtacaaaaattcttgaat
ggtttaactgtagttaagaccatttatgtaccgggtaaattatttagctttgtagcaaaa
taa

DBGET integrated database retrieval system