KEGG   Histophilus somni 2336: HSM_0712Help
Entry
HSM_0712          CDS       T00673                                 

Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsm  Histophilus somni 2336
Pathway
hsm00230  Purine metabolism
hsm00240  Pyrimidine metabolism
hsm01100  Metabolic pathways
hsm01110  Biosynthesis of secondary metabolites
hsm01130  Biosynthesis of antibiotics
Module
hsm_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hsm_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
hsm_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HSM_0712
   00240 Pyrimidine metabolism
    HSM_0712
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsm04131]
    HSM_0712
Enzymes [BR:hsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     HSM_0712
Membrane trafficking [BR:hsm04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    HSM_0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK DUF3546
Motif
Other DBs
NCBI-ProteinID: ACA32377
UniProt: B0USF1
Position
complement(821100..821525)
Genome map
AA seq 141 aa AA seqDB search
MTLEQTLAIIKPDAVERNLIGNIISRLEDKGFQIIAMKMLHLNQEQAEGFYAEHRNKAFF
TELVKYMTSAPIVVLVLQKENAVKDYRTFMGTTNPEIAENGTLRYEFAINQTQNSVHGSD
SLENAQREIAYFFAEAEIYAR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgacattagaacaaactttagcgattataaagcccgatgcagttgaacgaaatttaata
ggtaacatcatttctcgtttagaggacaaaggatttcaaatcattgctatgaagatgttg
catttaaatcaagaacaggcggaaggtttttatgcagaacatcgcaataaagcgtttttt
actgaattggttaaatacatgacatctgcccctatagttgttttggtgttacaaaaagaa
aatgcggtaaaagactaccgcacttttatgggaacaactaatccggaaatagcagaaaat
ggcacattacgttatgaatttgctattaatcaaacccaaaattccgttcatggctcggat
agtttagagaatgcacaacgtgaaattgcctatttttttgccgaagctgagatttatgct
agatag

DBGET integrated database retrieval system