KEGG   Histophilus somni 2336: HSM_0803Help
Entry
HSM_0803          CDS       T00673                                 

Definition
(GenBank) valyl-tRNA synthetase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
hsm  Histophilus somni 2336
Pathway
hsm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HSM_0803
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsm01007]
    HSM_0803
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsm03016]
    HSM_0803
Enzymes [BR:hsm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     HSM_0803
Amino acid related enzymes [BR:hsm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HSM_0803
Transfer RNA biogenesis [BR:hsm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HSM_0803
 Prokaryotic type
    HSM_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g Val_tRNA-synt_C tRNA-synt_1_2 ADIP ABC_tran_CTD tRNA-synt_1f SelB-wing_1
Motif
Other DBs
NCBI-ProteinID: ACA32476
UniProt: B0USP0
Position
919587..922451
Genome map
AA seq 954 aa AA seqDB search
MTKQFTMEDRFNPSAVEQALYQHWESRGYFKPSEDINAPSYCIAIPPPNVTGSLHMGHAF
QQTLMDTLIRFNRMEGNNTLWQTGTDHAGIATQMVVERKIAAEEGKTRHDYGREAFINKI
WDWKAYSGGTISQQMRRLGNSIDWDRERFTMDEGLSNAVKEVFVRLHEEGLIYRGKRLVN
WDPKLHTAISDLEVENKESKGSLWHFRYPLANGAKTAEGLDYLVVATTRPETMLGDTAVA
VHPEDERYQSLIGKTVVLPLANREIPIIADEYVDREFGTGVVKITPAHDFNDYEVGKRHG
LPMVNVMTLNADIRAEAEIIGTDGKPLAGYDAPIPADYQGLERFVARKKIVADFEALGLL
DQIKPHDLKVPYGDRGGVPIEPMLTDQWYVSVKPLAEVATKAVENGEIQFVPKQYENLYF
SWMRDIQDWCISRQLWWGHRIPAWYDEQGNVYVARDEAEVRSKYGLTSDVALKQDEDVLD
TWFSSGLWTFSTLGWPEQTKELKMFHPTDVLITGFDIIFFWVARMIMFTMHFIKDENGKP
QVPFKTVYVTGLIRDEQGQKMSKSKGNVLDPIDMIDGISLEDLLEKRTGNMMQPQLAEKI
AKATRKEFEHGISAHGTDALRFTLAALASNGRDINWDMKRLEGYRNFCNKLWNASRYVLT
HEKLDLSEGEAEYSLADRWIESQFNRTIDAFRTALKQYRFDLVANTIYDFTWNQFCDWYL
ELTKPVFAHGTDAQKRGTSRMLLNILEKLLRLAHPIIPFITEEIWQKLKGVMKLSGDTIM
LQPFPHAEESKFDPVAESQMDWLKEVIVAVRNIRAECNISPSHALELLLRNISEETKICL
ENNRTLLQSMAKLSTITLLDANEEPPLSVTKLVENNEIFIPMAGFINKEQELTRLTKEIE
KLKGEIVRIENKLSNEAFITKAPEQVIAKEREKMQGYLDNIEKLQQQYQAIETL
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaattcacaatggaagatcgtttcaacccttccgccgtagagcaagcactc
taccaacactgggaatcgcgaggctattttaaaccgagcgaagatattaatgcaccgagc
tactgtattgcgattccgccgccgaatgtgaccggttcgctacatatggggcacgctttc
cagcaaaccttgatggatactttaatccgcttcaaccgtatggagggcaacaacaccctt
tggcaaacgggaacagatcatgcaggtattgcgactcaaatggtggtggagcgtaaaatc
gcagcggaagagggcaaaacccgtcacgattatgggcgtgaagcctttatcaacaaaatc
tgggattggaaagcctattcgggcggtacgatcagccagcaaatgcgtcgcttaggcaac
tcgattgactgggatcgtgagcgttttacgatggacgaaggtttgtctaatgcggtgaaa
gaagtatttgttcgcttacacgaagaaggcttgatttaccgtggtaaacgcttggtgaat
tgggatccgaaactgcacactgccatttccgatcttgaagtcgaaaacaaagagagcaaa
ggctcgctttggcacttccgctatccgcttgctaacggtgcgaaaaccgctgagggctta
gattatttagtggtggcgaccactcgtcctgaaacaatgttgggcgatacagcggttgcg
gttcaccccgaagatgagcgttatcaatcgctgattggcaaaacggtcgtgctaccgctt
gccaaccgtgaaattccgattatcgctgatgaatatgtggatcgcgaattcggtacaggt
gtggtaaaaattacccctgcccacgatttcaacgactatgaagtgggcaaacgtcacgga
ttgccgatggtaaatgtgatgacgctcaatgccgatattcgtgcggaagcagaaattatc
ggcacagacggcaaaccgcttgccggctacgatgccccaattccagccgactatcaaggc
ttagagcgttttgtggctcgtaagaaaatcgtggctgattttgaagcgttgggcttgctt
gatcaaatcaaaccgcacgacttaaaagtcccctacggtgaccgtggcggtgtgccgatt
gagccaatgctgaccgatcaatggtatgtgagcgtgaaaccgcttgccgaagtcgccacc
aaagcggtggaaaacggcgaaatccaattcgtacctaaacagtatgaaaatctttacttc
tcttggatgcgtgatattcaagattggtgtatttctcgccaattatggtggggacatcgc
attccggcttggtatgatgaacaaggcaacgtttatgttgctcgagatgaggcggaagtg
cggtcaaaatacggcttaacttcagacgtagcgttaaaacaggatgaagacgtattagac
acttggttctcgtccggattatggacattctcaacacttggctggcctgagcaaaccaaa
gaactgaaaatgtttcacccgaccgatgtattaatcaccggttttgacatcatcttcttt
tgggtagcaagaatgattatgttcacgatgcacttcatcaaagatgaaaacggcaaaccg
caagtgccgttcaaaactgtgtatgtaacgggcttaatccgtgatgaacaagggcaaaaa
atgtcgaaatcaaaagggaacgtgttagacccgattgatatgattgatggtatcagtctt
gaggatttgcttgaaaaacgcaccggcaatatgatgcaaccacaattggcggaaaaaatt
gctaaagcaactcgtaaagaatttgaacacggcatttctgcacatggaacggatgcgtta
cgctttaccctggcggcgttagcgagcaatggacgtgatatcaattgggatatgaaacgt
ttggagggctaccgcaatttctgtaataaattatggaatgctagtcgttatgtattaacc
cacgaaaaattggatctaagtgagggcgaagcggaatattcgttggcggatcgttggatt
gagagtcaattcaaccgcactatagacgcatttcgcaccgcacttaagcaataccgtttc
gatttagtggcaaatacgatttacgattttacttggaatcagttctgcgattggtattta
gagctaaccaagcctgtatttgctcatggtacggatgctcaaaaacgtggtacaagtcgc
atgcttctcaatatattagagaaattattgcgtttagcacatccaattattccatttatc
acggaagaaatttggcagaaattgaagggtgtaatgaagttatcaggcgataccattatg
ttacagccatttccgcacgcagaagaaagtaagtttgatccggtagcggaaagccaaatg
gattggttaaaagaagtgattgtagcagtgcgtaatattcgtgcggaatgtaatatttca
ccgagtcatgcgttggaactgttgctgagaaacatttcagaggaaacaaaaatttgtctt
gaaaataaccgcactttattacaatctatggcaaaattgtccacgattactttactggac
gccaatgaagaaccgccactttcggtcacgaaactggttgaaaataatgaaatttttatt
ccaatggcaggttttattaataaagagcaagaactcacaagattgactaaagaaattgaa
aaattgaaaggtgaaattgttcgaattgaaaacaaactcagcaatgaagcctttattacc
aaagcaccggagcaagttatcgccaaagagcgggaaaaaatgcaggggtatttggataat
atagaaaaacttcaacaacaatatcaggcgattgagacgttgtaa

DBGET integrated database retrieval system