KEGG   Histophilus somni 2336: HSM_1329Help
Entry
HSM_1329          CDS       T00673                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
hsm  Histophilus somni 2336
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsm03016]
    HSM_1329
Enzymes [BR:hsm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     HSM_1329
Transfer RNA biogenesis [BR:hsm03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    HSM_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ACA31064
UniProt: B0UU52
Position
1512889..1513611
Genome map
AA seq 240 aa AA seqDB search
MSEPIELDILYQDEFLVVVNKPAGMLVHRSWLDRHETQFVMQTLRDQIGQHVFPIHRLDR
PTSGVLLFALNAGIANLLCSQFELKQVKKSYLAIVRGYLSDAQRIDYPLKVQLDKIADKF
SRKEELQDAITDYYGLKTVEMPYGVGRYSSSRYSLVRLMPYTGRKHQLRRHLKHIFHPIL
GDTQYGDLHQNRAFSQNLGVSRLMLHAEKLCFQHPVTNETIEIVADLDEQWKLLFKIFNW
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagccaatagaattggatattttatatcaagatgagtttctcgttgtagtgaat
aaacctgccggaatgttggttcaccgcagttggctagatcgtcatgaaactcaatttgtc
atgcaaactttacgagatcaaattggtcaacatgtttttcctattcatcgtttagatcgt
ccaacatcaggtgttttactttttgccttaaatgctggaattgctaatttattatgttca
caatttgaattaaaacaagtgaaaaaaagctatttggcgatagttcgtggttatttgagc
gatgctcaacgaattgattatccgcttaaagtgcaactggacaaaattgcagataaattt
agtcgaaaagaagaactgcaagatgcaataacggattattatggtttaaaaaccgttgaa
atgccttatggcgtagggcgttatagctcttcccgctattcacttgtacgtttaatgcct
tatacgggacgtaagcatcaattacgtcgccatttaaagcatatttttcatcctattttg
ggtgatactcaatatggtgatttacaccaaaatcgggctttcagtcaaaatcttggtgta
agcaggttaatgttacatgctgaaaaactttgttttcaacatccggtaactaatgaaaca
atagaaattgttgctgatttagatgagcaatggaaattgttattcaaaatatttaattgg
taa

DBGET integrated database retrieval system