KEGG   Histophilus somni 2336: HSM_1403Help
Entry
HSM_1403          CDS       T00673                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
hsm  Histophilus somni 2336
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HSM_1403
Enzymes [BR:hsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     HSM_1403
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     HSM_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: ACA31145
UniProt: B0UUC4
Position
complement(1600630..1601631)
Genome map
AA seq 333 aa AA seqDB search
MKPILGITMGDAAGIGPEVIIKALADKRIYELAHPVVIGDQKIMQRALPIVHSELKLRIL
NDLDSFTAEYGVIDILDLNNLSEDLPFAQIDPRAGKAAYEYIEKAVKLAMEGKIQAIVTA
PLNKEALHASGKMFPGHTEILATLSNTKDYSMMLTSEKLNVIHVTTHVQLRKACDLVTKE
RVATVIDLAEENARILGFKEPRIAVAGLNPHSGENGMFGDEDQKEIVPAILAAQAKGFNV
TGPIPPDTLFHRAANLNEFDIVVVMYHDQGHIPIKLLGFDTGVNVTVGLPFIRTSVDHGT
AFPIAGKGVADSRSMSEALYLGAKMANIKYATH
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctattttaggaattacgatgggagatgccgcaggtatcggcccagaagttatt
attaaagcattggctgataaacggatttatgagttagcacacccagttgttatcggcgat
caaaaaattatgcaacgagctttacctattgttcattcagaactgaaattaagaatatta
aatgatctagatagctttacggcagagtatggtgttattgatattttagatttgaataac
ttatcagaagatttgccttttgctcaaattgatcctcgtgctggtaaagcggcttatgaa
tacatcgaaaaagccgttaagttagcgatggaagggaaaatccaagctattgttacagcc
cctttaaataaagaggcattacatgcaagtggtaaaatgtttcccggtcatactgaaatt
ttagctacccttagtaatactaaagattactcaatgatgctaaccagcgaaaaactcaac
gttattcacgttactactcacgtccaacttcgtaaagcttgtgatttagttactaaagaa
cgagttgccactgttattgatttggcagaagaaaatgctcgtattcttggttttaaagag
cctcgtattgctgttgccggtttaaaccctcattctggtgaaaatggaatgtttggtgat
gaagatcaaaaagaaatcgtacctgcaattctagcagctcaagccaaaggatttaatgtt
acaggacctataccaccggatactttatttcatcgtgcagctaatctaaacgagttcgat
attgtcgtcgtgatgtaccacgatcaaggacatatccctatcaaattattaggttttgat
acaggtgtaaatgttactgtcggtcttccatttattcgaacatctgtcgatcacggcact
gcatttccgattgcaggaaagggagttgccgatagccgtagtatgtctgaagcactctat
ctaggtgcaaaaatggcaaatatcaaatatgcaacacactaa

DBGET integrated database retrieval system