KEGG   Histophilus somni 2336: HSM_1692Help
Entry
HSM_1692          CDS       T00673                                 

Definition
(GenBank) conserved hypothetical protein
Organism
hsm  Histophilus somni 2336
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2461
Motif
Other DBs
NCBI-ProteinID: ACA31465
UniProt: B0UVG8
Position
1941973..1942401
Genome map
AA seq 142 aa AA seqDB search
MRKLLGITVLTLCTTSAFATDKNVVFSCTSTEGKPLTVKRVGNDYEYSYDKTIFKNPIKK
AVTNDGSIIARGSGFTTYALELKNDGLKYVVGFVQPNGNSKEFIEPGATISRDNDQPSIG
SVDCDPYKKIYYKFDVHLMNTL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaattattaggtattactgtacttacactttgtacaacttcagcatttgcaacg
gataaaaatgtggtattttcttgtaccagcacagaaggtaaacctctcacagttaaacgg
gtaggaaatgattacgagtattcgtatgataaaactatcttcaaaaacccaatcaaaaaa
gcggtgaccaacgatggctcaattatcgctagaggatcaggttttaccacgtatgcatta
gaactgaaaaatgatggtttgaagtatgtagttgggtttgttcaaccaaatggtaactca
aaagagtttattgagcctggagcaacgattagccgtgataatgatcaaccaagcattggc
tctgtagattgtgatccttacaaaaaaatctattataagtttgatgttcatttaatgaat
accttgtaa

DBGET integrated database retrieval system