KEGG   Histophilus somni 2336: HSM_1694Help
Entry
HSM_1694          CDS       T00673                                 

Definition
(GenBank) hypothetical protein
Organism
hsm  Histophilus somni 2336
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3742
Motif
Other DBs
NCBI-ProteinID: ACA31467
UniProt: B0UVR3
Position
1943108..1943449
Genome map
AA seq 113 aa AA seqDB search
MKFIDFGKQLANPVKFIKQNTAFLPKPIQQVVVFAVIFAGLPLFILGFFILRIWAYKHIS
LYSEYKDMANSEISSKDTDLKSLFSDDEEQEDDEYQYGYDGPGIYLGNYRVDE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatcgatttcggaaagcagctcgctaacccagttaaatttatcaaacagaat
actgcatttttacctaagcctattcaacaagtggtcgtttttgcggtaatttttgcagga
ttgcctctatttatcttgggtttctttattctcagaatatgggcttataagcatatttct
ttgtatagtgaatataaagatatggctaattcagaaatatcgtctaaagatacagattta
aaatcacttttttctgatgatgaagaacaagaagatgatgaatatcaatatgggtatgat
ggaccaggtatatatctaggtaattaccgtgttgatgagtaa

DBGET integrated database retrieval system