KEGG   Histophilus somni 2336: HSM_1702
Entry
HSM_1702          CDS       T00673                                 

Definition
(GenBank) conserved hypothetical protein
Organism
hsm  Histophilus somni 2336
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ACA31477
UniProt: B0UVS1
Position
complement(1951314..1951958)
AA seq 214 aa
MSQLKSQLHEKDKHIKTTRIFAFLFFIIILVLAGVIYTFPSRLTIYNPPDLRAGSQRAWW
EIPKPTIYAFSYQIFQQMNRWMTNGEEDYEKNITTLKPFLTPHCEAFLRQDYKDRLRNNE
LRSRTRMVYEITGRGYSEDKVTIFSEDSWAVNLDLSVDEHFQGQPVKRVYIRFPISIVRM
DVDSAQNPWGLGFNCYHSIPKLLEGVEPKTEEKK
NT seq 645 nt   +upstreamnt  +downstreamnt
atgagccagttaaaaagccaattacacgaaaaagataaacatatcaaaacgactcgaatt
tttgccttcctgtttttcattattattttggtactggcaggcgtaatctatactttccca
agtcgccttacgatatacaacccaccagatctgcgtgctgggagccaacgagcttggtgg
gaaattcctaaaccaacaatttatgcattctcctatcaaattttccagcaaatgaatcgg
tggatgacaaatggcgaagaggattatgagaaaaatatcaccaccctcaaaccattttta
acaccacactgtgaagcatttttacgacaagattataaagatcgtctgcgtaacaatgaa
ctacgcagccgaacccgtatggtgtatgaaattaccggtagaggatatagtgaagataaa
gttaccatattcagtgaagatagttgggctgtcaatcttgatttaagtgtggatgaacat
ttccaaggacagccggtaaaacgagtttatattcgttttcctatcagtattgtgagaatg
gatgtcgattctgctcaaaacccttggggattagggtttaattgctatcactccattcca
aaactcttagaaggtgttgagccaaaaacagaggagaaaaaataa

DBGET integrated database retrieval system