KEGG   Histophilus somni 2336: HSM_1704
Entry
HSM_1704          CDS       T00673                                 
Name
(GenBank) Haemophilus-specific protein, uncharacterized
Organism
hsm  Histophilus somni 2336
SSDB
Motif
Pfam: DUF2976 Sensor DUF6366 DUF6480 Pox_EPC_I2-L1 DUF6773
Other DBs
NCBI-ProteinID: ACA31479
Position
complement(1952350..1952739)
AA seq 129 aa
MNRIKSLTKHLHSRYLAVMLFFWGSLQNAFAAGPDASKIPDFQIPGVDSNTKDPMEIIWI
VLKGLVTLGAVILAAVAILTVVKALIGIYNEATSENGKKGWGHFILALIIGFIVIFFCLW
LVKLAVGLF
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaaccgcattaaatctcttacgaaacatctgcatagtcgttatttggctgtaatgctc
ttcttctggggttccctccaaaatgcatttgcagccggtcctgatgcttccaaaatccca
gacttccaaattccaggcgtggatagtaataccaaagatccaatggaaattatttggatt
gttctgaaaggtcttgtcactctcggagctgttattttagcagccgtagccattttgaca
gttgttaaagcattgattggcatctataacgaagctacatctgaaaatggtaaaaaaggt
tggggacactttattctcgccttaattatcggctttattgtgattttcttctgcttgtgg
ttagtcaaacttgcagtcggactcttctaa

DBGET integrated database retrieval system