KEGG   Histophilus somni 2336: HSM_1710
Entry
HSM_1710          CDS       T00673                                 
Name
(GenBank) conserved hypothetical protein
Organism
hsm  Histophilus somni 2336
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind T4SS-DNA_transf AAA_22
Other DBs
NCBI-ProteinID: ACA31486
UniProt: B0UVS9
Position
complement(1954953..1957154)
AA seq 733 aa
MSAKHTLEAWLRPPVEFFPAAVHASCAFVSAAAPWSLALHPSIGYSIAAGFGALSFYRAK
QGWQIVRYHRNLKRLPNYSMTSKQIPVSNKYLFVGKGFEWKPIHTQRLHDCFSDNGSKYL
EPSKLFKMAREYEKRHENWLTHLTSKDSRWNLVRPLPPVEGIPAIHGIEPDEVDVVQSVS
SRVGHTVVFGTTRVGKTRLAEVFVTQDIHRGKTADEREVVVFFDPKGDADMLKRMYAEAK
RAGREDEFYVFHLGYPEISARYNPVGRFNRISEVAGRISGQLSGAGNSAAFKEFAWRFVN
IVARALVELGNRPNYVQISQFVQNIDSLFLDYAEKFIRKTDPKIWENLATIAAGLDEKAL
PFGMKDRPLIFVINKYIAESAVFDPILQGLASAVRYDRTYFDKIVASLLPLLEKLTTGKI
SELLSPDYADILDERPIFDWESIIRKRGIVYIGLDALSDATVAAAVGNSMFADLVSMAGH
LYKFGTNDGLPGAFKEKSKPVKINLHCDEFNELMGDEFIPLINKGGGAGIQVTAYTQTLS
DIEARIGSKPKAGQTLGNFNTLYMLRVKEPATAELLTKQLHEVTIKRSTVTSSTTDSSNP
DDDKAFSSNTGQRISESTVPMLVPANITNLPKGQAFALMDGSKLWKIRMPLPAVDKDDMM
PQSLRELTDYMRKNYHVVENWWQPAFTEYTPSRDIAEAFEAMSEPQYKTQIDHQVDNFGI
DEPYDIDEEENDE
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgtctgctaaacataccttagaggcgtggttacgacctcctgttgaattttttccggca
gcggttcacgcttcttgtgcctttgtcagtgctgcagctccttggtctttggcactccat
ccaagtatcggttacagtattgcagctggttttggagcattgagcttttatcgggcaaaa
caaggttggcaaattgtgcgttaccatcgcaacctgaaacgtttgcctaattattcaatg
acaagcaagcaaattccggtcagtaataagtatctgtttgtcggtaagggatttgaatgg
aaacctattcacactcaacggttacacgattgtttttcggataacggttcaaaatatctg
gagccttctaagctatttaaaatggctcgtgagtatgaaaaacgacacgaaaattggcta
acacatcttacctcaaaggatagccggtggaatctggttagacctctgccacctgttgag
ggtattcctgctatccatggaattgagccggatgaggttgatgtcgttcaatccgttagc
tctcgggttgggcatacggtagtattcggtacaacacgtgtcggtaaaactcgtttagct
gaggtctttgttacccaggatatccaccgaggtaaaactgctgatgagcgtgaagtggta
gtcttctttgatccgaaaggcgatgccgatatgctcaaacgaatgtatgcggaggcaaaa
cgagcggggcgagaagatgagttttatgttttccatctaggttatcccgaaatttctgcc
cgttataacccagtaggacgctttaatcgtatttcggaagtcgctgggcgtatttcagga
cagctaagtggagcgggtaactcggcggcatttaaagagttcgcttggcgatttgtcaat
atcgtcgcacgtgcattagttgaattgggaaatcgcccaaactatgttcaaatttcccag
tttgtacaaaatattgattcattattccttgattatgcggaaaaattcattcgtaaaacc
gatccaaaaatttgggaaaatttagcaaccatcgccgctggactggatgaaaaagcactt
cctttcggaatgaaagaccgtccgctgatttttgtgatcaacaagtacattgctgaaagt
gcagtctttgacccaattctacaaggacttgccagtgctgtacgctatgaccgtacctat
ttcgataaaattgttgcctcattgttgccgttattggaaaaattaacgacagggaaaatt
tctgagctgttatccccggattatgctgatattttggatgaacgtccgatttttgactgg
gaatccattattcgtaaacgaggaatcgtttatattggtttagatgctctctctgatgcg
acagttgcggccgctgtaggaaacagtatgtttgctgacttagtctcaatggcaggtcat
ttatataaatttgggacaaatgacggattaccgggagcattcaaagaaaaatccaaacca
gtgaaaattaatcttcattgtgatgaatttaatgaattgatgggtgatgaatttatccct
ctcatcaacaaaggcggtggtgctggaatacaagtaactgcttatacacaaacactctcc
gacattgaagctcgtatcggcagtaaaccgaaagcgggacaaaccttaggtaacttcaat
acactctatatgctgagggtaaaagaaccggctacggcagaattactcacaaaacagtta
cacgaagtgacgattaaacgtagcacggtcacgtccagtacaactgactccagtaatcct
gacgatgataaggcgtttagctccaataccggacagcgtatcagcgaaagtaccgttcct
atgttggttccggccaacattaccaatttaccaaaaggacaagcattcgctttaatggac
ggtagtaaattatggaaaattcgaatgccgttacctgctgtcgataaagatgatatgatg
cctcaatctttacgagagctgacagattatatgcgtaaaaactatcacgttgttgaaaat
tggtggcaaccggcatttacagaatatacgccgtcccgagacattgcagaagcatttgaa
gcgatgtcggagcctcaatataaaacacagatagaccatcaagtagataatttcggcata
gatgaaccttacgatattgatgaagaggaaaatgatgagtag

DBGET integrated database retrieval system