KEGG   Histophilus somni 129PT: HS_0350Help
Entry
HS_0350           CDS       T00386                                 

Gene name
mraW
Definition
(GenBank) S-adenosyl-methyltransferase
  KO
K03438  16S rRNA (cytosine1402-N4)-methyltransferase [EC:2.1.1.199]
Organism
hso  Histophilus somni 129PT
Brite
KEGG Orthology (KO) [BR:hso00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hso03009]
    HS_0350 (mraW)
Enzymes [BR:hso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.199  16S rRNA (cytosine1402-N4)-methyltransferase
     HS_0350 (mraW)
Ribosome biogenesis [BR:hso03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    HS_0350 (mraW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_5 Methyltransf_31 Methyltransf_25 Methyltr_RsmB-F Methyltransf_24 Cob_adeno_trans
Motif
Other DBs
NCBI-ProteinID: ABI24628
UniProt: Q0I1E1
Position
355570..356529
Genome map
AA seq 319 aa AA seqDB search
MQDTFSSPEHFTVLLREAVGGLALKENGIYIDGTFGRGGHSRFILSQLSKKGQLIAIDRD
PQAIQVAQNIQDSRFRIVHDSFSAIPDICEKLGLTGKIDGILLDLGVSSPQLDNAERGFS
FMKDGPLDMRMDTTQGLSATEWLRLVSEQDLAWVLKTFGEERFAKRIAQAIVGYNKSAVQ
SGAEPLNRTLQLAELIAQSVPFKDKYKHPATRSFQAIRIFINSELDELEKVLNGALNVLA
PQGRLSIISFHSLEDRMVKHFIRKQSKGDDLPKGLPLREEQIQHNQKLKPVGKAIMPTEQ
EMAANVRSRSAVLRIAERI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatacattttcttcacctgagcatttcactgttttattaagagaagcagttggc
ggtttagccttaaaagaaaatggtatctatattgatgggactttcggtcgaggcggtcat
tctcgttttatcctttctcaactgtcaaaaaagggtcaattaattgcgattgatcgtgat
ccccaagcaattcaggttgcacaaaatattcaagattcacgttttcgtattgtgcatgac
agcttttcagctattccagatatttgtgaaaaattaggattgacgggcaaaattgacggg
attttacttgatcttggcgtgtcatctccacaacttgataatgcggaaaggggattcagt
ttcatgaaagatggtcctttggatatgcgtatggatacgacacaaggattatcagcaacg
gaatggttgaggctggtttctgaacaggatttagcatgggtattgaaaactttcggtgaa
gaacgctttgccaaacgtatagctcaggcgattgtaggatataacaaaagtgcggtgcaa
agtggagcagaacctttaaacagaactttacaattagctgaactgattgctcagtctgta
ccttttaaagataagtataagcatcctgcaacgagaagtttccaagctattcgtattttt
attaattccgaattagatgaattagaaaaagtattgaatggagctttaaatgttctcgct
cctcaaggacgtctgtcgattatcagctttcattctctagaagatcgtatggtaaagcat
tttatacgtaagcaaagtaaaggtgatgatttgcccaaaggattgccattgcgtgaagag
caaattcaacataatcaaaaattaaaacctgttggtaaagcgattatgccgacagaacaa
gaaatggctgctaatgtccgttcaagaagtgcggtcttacgcattgcggagagaatataa

DBGET integrated database retrieval system