KEGG   Haemophilus somnus 129PT: HS_0619Help
Entry
HS_0619           CDS       T00386                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
hso  Haemophilus somnus 129PT
Pathway
hso00220  Arginine biosynthesis
hso00250  Alanine, aspartate and glutamate metabolism
hso00290  Valine, leucine and isoleucine biosynthesis
hso01100  Metabolic pathways
hso01110  Biosynthesis of secondary metabolites
hso01130  Biosynthesis of antibiotics
hso01210  2-Oxocarboxylic acid metabolism
hso01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hso00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HS_0619
   00290 Valine, leucine and isoleucine biosynthesis
    HS_0619
   00220 Arginine biosynthesis
    HS_0619
Enzymes [BR:hso01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HS_0619
    2.6.1.66  valine---pyruvate transaminase
     HS_0619
Amino acid related enzymes [BR:hso01007]
 Aminotransferase (transaminase)
  Class I
   HS_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABI24896
UniProt: Q0I314
Position
665297..666511
Genome map
AA seq 404 aa AA seqDB search
MRVFPKSDKLEHVCYDIRGPVHQEALRLEEEGKKILKLNIGNPAPFGFEAPDEILVDILR
NLPAAQGYCDSKGLYSARKAIVQYYQSKNILSATVNDVYIGNGVSELITMSLQALLNDGD
EVLIPMPDYPLWTAAATLAGGKAVHYLCDEQADWFPDVADIKSKVTSRTKAIVIINPNNP
TGAVYSKELLLDIVEVARQNGLMIFADEIYDKILYDNAVHHHIAALAPDLLTVTFNGLSK
SYRVAGFRQGWMILNGPKHQAKGYIEGLDMLASMRLCANHPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNKAYELINQIPGLSCTKPMGALYMFPKIDTKKFNIYDDEKMVLDLLRQEK
VLLVHGRGFNWQQPDHFRIVTLPYVNQIEDALGRLARFLEYYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgagttttccctaaatccgataagttagaacatgtatgctacgatattcgtggaccg
gtacatcaagaggcgttacgtttggaagaagaaggcaaaaagatcttaaaattaaatatt
ggtaatccagcaccattcggttttgaagctcctgatgagattttggtagatattttgcgt
aatttgcctgccgcacaaggatattgtgattcaaaaggtctatattctgcacgtaaagct
attgttcaatattaccaatctaagaatattttaagtgcgaccgtaaatgatgtatacatc
ggtaatggtgtttctgaacttattactatgtcattacaagcattgttgaatgatggtgat
gaggtgttaatcccaatgcctgattacccattatggacggctgctgcaacgttagccggc
ggaaaagcggttcattatttatgtgatgaacaagctgattggtttcctgatgtggcagat
ataaaaagtaaggttacttctcgcacaaaagccattgttattattaatcctaataatcca
acgggagctgtttatagtaaagaattattattagatatagttgaagtagctcgccaaaat
ggattgatgatttttgccgatgaaatttacgataaaattttatatgacaacgctgttcat
catcatatcgccgcattagcaccggatttgttaacggttactttcaacggcttatcaaaa
tcttatcgtgtagcaggatttcgccaaggttggatgattttaaatggaccaaaacatcaa
gcaaaaggctatattgaaggcttggatatgttggcatcaatgcgtttatgtgcaaatcat
cctatgcaacatgcgatccaaactgctttaggtggatatcagagtatcaatgaatttatt
ttaccgggtggtcgtttattagaacaacgtaataaggcttatgagctgattaatcaaatt
ccgggattaagttgcacaaaaccgatgggcgcactttatatgttcccgaaaattgatact
aaaaaattcaatatctatgatgatgaaaaaatggtattggatttattgcgtcaagagaaa
gtgttattagttcatggacgtggttttaactggcagcaaccagaccattttagaatagta
accttaccttatgttaatcaaattgaagacgctttaggtcgattagcaagatttttagag
tattatcgtcagtaa

DBGET integrated database retrieval system