KEGG   Histophilus somni 129PT: HS_1191Help
Entry
HS_1191           CDS       T00386                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hso  Histophilus somni 129PT
Brite
KEGG Orthology (KO) [BR:hso00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HS_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABI25466
UniProt: Q0I3V5
Position
1343535..1344797
Genome map
AA seq 420 aa AA seqDB search
MEILQEYGTILVIITAVFGFLMAFGVGANDVANAMGTSVGSGTITAKQAIFIAMFFECAG
AYLAGGEVTETIKSGVIDPMQFTDTPEILVFGMMAALFSSGIWLLIASKMGWPVSTTHAI
IGAIVGFACITVGAHAVDWGTVRNIVGSWFITPILAGIIAYAIFFSTQKLIFDTPKPLAN
AQKYGPFYMGLTVLILAIVTMTKGLKHIGLHLTTIETLIISGIISIIAGILGSFYFRSQR
FIQNVTKGTFGAVEKVFSILMLLTACAMAFAHGSNDVANAVGPLSAVVSIIEHGGEIAGK
TTLAWWILPLGSVGIGVGLIVMGYKVMSTIGTGITDLTPSRGFAAQFATAVTVVLASGTG
LPISTTQTLVGAILGIGFARGIAAINLTVIRNIVASWIVTLPAGTFFAIVIYYIIYAIFH
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttacaagaatacggaactatacttgttattattaccgccgttttcggtttt
ttgatggcatttggtgtgggtgctaatgatgtagcaaatgccatggggacatcagtaggt
tcaggtactattacagcaaaacaagcaatttttattgcgatgttttttgaatgtgcggga
gcttacctcgcaggaggagaagtaacagaaacgattaaaagtggcgttatagatccaatg
cagtttactgatactccggaaattttggttttcggtatgatggcagctcttttttcatcg
gggatttggttattaattgcctcaaaaatgggttggccggtttctacaactcatgcaatt
atcggtgcaattgtcggttttgcttgtattactgtcggtgcacatgcagttgattgggga
actgtacgcaatattgtgggaagttggtttatcacccctattctcgccggaattattgct
tacgctattttctttagtacacaaaagttaatctttgacacgccaaaacctttagctaat
gcccaaaaatacggacctttttatatgggactgaccgttcttattttagctattgtaact
atgacgaaagggctaaaacatattggattacatttaactaccatagaaacactgattata
tccggtatcattagtattattgcgggtattcttggttctttttattttcgtagccaacgt
ttcattcaaaatgttacgaaaggaacctttggagcagttgaaaaagtatttagtatttta
atgctattaactgcctgtgcaatggcatttgctcatggttcaaatgacgttgccaacgca
gtgggtcctttgtccgccgttgtttccatcatagaacatggtggtgagattgcaggaaaa
actaccctggcttggtggatcctgcctcttggctctgtcggcattggagtaggtttaatt
gttatgggttataaagtaatgtcaacgatcgggacaggcattacagacctcacgccaagt
cgtggtttcgctgcccaatttgccactgctgtaacagttgtcttagcatcaggaaccgga
ttacctatatcaacgactcaaacacttgttggtgctattttaggtattggttttgcacgt
ggtattgcagcaattaacttaaccgttattcgtaatattgttgcttcttggattgttaca
ttacctgcgggtactttctttgctattgtgatttattacattatttatgcgatttttcat
taa

DBGET integrated database retrieval system