KEGG   Histophilus somni 129PT: HS_1229Help
Entry
HS_1229           CDS       T00386                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
hso  Histophilus somni 129PT
Pathway
hso00860  Porphyrin and chlorophyll metabolism
hso01100  Metabolic pathways
hso01110  Biosynthesis of secondary metabolites
hso01120  Microbial metabolism in diverse environments
Module
hso_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:hso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HS_1229 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hso01007]
    HS_1229 (hemL)
Enzymes [BR:hso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     HS_1229 (hemL)
Amino acid related enzymes [BR:hso01007]
 Aminotransferase (transaminase)
  Class III
   HS_1229 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABI25504
UniProt: Q0I3R7
Position
1395605..1396903
Genome map
AA seq 432 aa AA seqDB search
MTTSATLFSRAQQVIPGGVNSPVRAFKGVGGTPVFIEKANGAYIFDTEGKQYIDYVGSWG
PMILGHNHPSILSAVLKTAENGLSFGTPTPLEIELAELICQLVPSIEMVRMVNSGTEATM
SAIRLARGYTKRDKILKFEGCYHGHSDSLLVKAGSGSLTLGQPSSPGVPEDFAKHTITCE
YNNLQSVKNAFEQYPDQIACVIVEPVAGNMNCILPKQDFLQGLRQLCNEYGSLFIIDEVM
TGFRVALGGAQSYYEVTPDLTTLGKVIGGGMPVGAFGGKKEIMQYIAPTGPVYQAGTLSG
NPIAMSAGIACLNELKKEGNEQRLAMLTKKLALGLKNLANQHNIPLVVNYVGGMFGIFFT
TQNEVTSYQQAIQCDVEKFNLFFHKMLEQGVYLAPSAFEAGFMSLAHTDADIDRTLQAAD
IAFASLCSSSFS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttcagcgacattattctctcgtgcacaacaagttattccaggcggagtaaac
tctccagttagagcatttaaaggtgtgggcggaacgccagtgttcatagaaaaagccaac
ggtgcgtatattttcgatacagaaggaaaacaatatattgactacgtaggttcttgggga
ccaatgattttaggtcataaccacccatcaatcttaagtgcggtactaaaaacagcagaa
aatgggctaagttttggaacacctacaccgcttgaaattgaacttgcggaactgatttgt
caattagtcccatcaattgaaatggtgagaatggtcaattcgggaacagaggcaactatg
tcagctattcgtttggctagaggctatactaaaagagataaaattttaaaatttgaaggc
tgttatcatggtcactcggatagtttgcttgtcaaagccggctccggatctttgactttg
ggacaaccaagctctcctggtgttccggaagactttgctaaacataccatcacttgcgaa
tataataatcttcaatctgtcaaaaatgcttttgaacaatatcctgatcagatcgcctgc
gttatcgttgagcctgttgcaggtaacatgaactgcatccttccgaaacaggatttttta
caaggcttgcgtcaactttgcaatgaatatggttctctatttattattgatgaggtcatg
acaggatttcgtgtagccttaggcggtgcacaatcttactatgaagtgacacctgatcta
acaacattaggaaaagtcattggaggaggtatgcccgttggtgctttcggaggcaaaaaa
gaaattatgcaatatattgcacctacaggtcccgtatatcaagcaggaacattatcagga
aatccaattgctatgtctgccggaatcgcatgcttaaatgaattgaaaaaagaaggtaac
gaacaacgtttagcaatgctcacaaaaaaattggcattaggtttaaaaaacttagcaaat
caacacaatatcccgcttgtagtcaattatgtaggcggaatgtttggcatcttctttacc
acacaaaatgaagttacctcttaccaacaagcaattcaatgtgatgttgaaaagtttaat
ctatttttccacaaaatgttagaacaaggtgtttatcttgcaccatctgcatttgaagca
ggtttcatgtcattagcacacactgacgcagatattgaccgcactttacaagcggcggat
attgcttttgccagtttatgctcatcatcattttcctaa

DBGET integrated database retrieval system