KEGG   Histophilus somni 129PT: HS_1251Help
Entry
HS_1251           CDS       T00386                                 

Gene name
mtlD
Definition
(GenBank) D-mannitol 1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
hso  Histophilus somni 129PT
Pathway
hso00051  Fructose and mannose metabolism
hso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HS_1251 (mtlD)
Enzymes [BR:hso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     HS_1251 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP DUF5300 3HCDH_N B12-binding
Motif
Other DBs
NCBI-ProteinID: ABI25526
UniProt: Q0I4Y2
Position
complement(1434151..1435302)
Genome map
AA seq 383 aa AA seqDB search
MNALHFGAGNIGRGFIGKVLADSGVQVTFADVNEAVIDLLKRHQSYNVKIVGDSINAMES
VRHVTGVDSKDTNALIELFKTVDLVTTAVGPTVLKIISGTIAKGIEARLAAGNFKPLNII
ACENMVRGTTFLKEQVFTHLTEELQADAEKYVGFVDSAVDRIVPPVQEDISDPLLVTVEE
FCEWIVDNTQFKGDIPNIQGMELTDNLMAFVERKLFTLNTGHAVTAYFGKRKGYQFVKES
IEDPDIKEFVAAVMQESGAVLIQRYGFEPQAHAAYIEKILKRFANPYLVDNVERVGRQPL
RKLSYNDRLIKPLRGTIEYNLANQHLIRAIAYALTFRCEDDPQAVELAQSLAEIGVTETL
KKYTELQDVVIIEQIAQAYNEVK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcattacatttcggagcaggtaatatcggtcgtggttttatcggcaaagtatta
gctgatagcggagttcaagtaacctttgccgatgtgaatgaagcggtaattgatctattg
aaaagacatcaatcttacaacgtgaaaatcgttggcgacagcattaatgcgatggaaagc
gtacgtcatgttacgggggtggattcaaaagacacaaatgctttgattgagctgtttaaa
acggttgatttagttaccactgctgttggtcctaccgtgttaaaaattatttctggtact
atcgccaaaggtattgaagctcgtttagccgcaggcaattttaagccgttaaacattatc
gcttgtgaaaatatggttcgtggaacgacctttttaaaagagcaggttttcacacatctt
acagaggaattgcaagcagacgctgaaaaatatgtaggtttcgttgatagtgcggtagat
cgcattgtgccacctgtgcaagaagatatatcggatcctttgttggtaacagtagaggaa
ttttgtgaatggatcgtagataacacccaattcaaaggtgatattccaaacattcaagga
atggaattaactgataatttgatggcatttgtagagcgtaaattattcaccttgaataca
ggacacgccgtgaccgcttatttcggcaaacgcaaaggctatcaattcgtgaaagaaagc
attgaagatcccgacatcaaagagtttgtagcggctgtcatgcaagaaagcggtgcagtg
ttaattcagcgttacggttttgaaccgcaagcacatgccgcttatattgaaaaaattctc
aagcgttttgctaatccgtatttagtagataatgtggaacgtgtgggtcgccagccctta
cgcaaattaagctacaatgatcgcttaatcaaaccattgcgtggtactattgaatacaat
ttagctaatcagcatctaattcgtgcaatagcttacgcactgactttccgttgtgaagat
gatccgcaagcagtagaattagcacaatctttggcagaaatcggtgtaacagaaacgttg
aaaaaatacacggaattgcaagatgtcgttattattgagcaaatagctcaagcctataat
gaagtaaaataa

DBGET integrated database retrieval system