KEGG   Histophilus somni 129PT: HS_1433Help
Entry
HS_1433           CDS       T00386                                 

Gene name
clpX
Definition
(GenBank) ATP-dependent Clp protease ATP-binding subunit ClpX
  KO
K03544  ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
hso  Histophilus somni 129PT
Brite
KEGG Orthology (KO) [BR:hso00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hso03110]
    HS_1433 (clpX)
Chaperones and folding catalysts [BR:hso03110]
 Heat shock proteins
  HSP100
   HS_1433 (clpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 zf-C4_ClpX ClpB_D2-small AAA AAA_5 AAA_22 Mg_chelatase RuvB_N MCM Sigma54_activat AAA_18 Sigma54_activ_2 AAA_7 AAA_14 AAA_16 AAA_24 T2SSE TIP49 TsaE IstB_IS21 NACHT RNA_helicase AAA_33 ABC_tran AAA_21 AAA_15 PduV-EutP DEAD AAA_8 AAA_29 PhoH AAA_28 ResIII DUF1296 AAA_25 AAA_23
Motif
Other DBs
NCBI-ProteinID: ABI25708
UniProt: Q0I4F0
Position
1620446..1621690
Genome map
AA seq 414 aa AA seqDB search
MTKEKELHCSFCGKEQKEVDKLIAGTSGYICNECIELCHDMLANADDIEEIDEEFQEEEP
KLPTPHEIRAHLDDYVIGQDYAKKVLAVAVYNHYKRLRSEKNTSEVELGKSNILLIGPTG
SGKTLLAQTLARMLNVPFAMADATTLTEAGYVGEDVENVLQKLLQNCDYDIEKAQQGIIY
IDEIDKITRKSENPSITRDVSGEGVQQALLKLVEGTVASIPPQGGRKHPQQEMLRVDTSK
ILFICGGAFAGLDKIIEKRTNTGGKGIGFGADVRIDEEKVSLTELFKQVEPDDLMKFGLI
PEFIGRLPVIAPLSELDEEALVKILTEPKNALTKQYQVLFSLENIELEFTQEALIAMAKK
ALARKTGARGLRSIVETLLLDTMYDLPSIENLQKVIVEEETVTENKAPVLKFNS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaaagaattacattgctctttttgtggtaaggaacaaaaagaagtagat
aaattaattgcaggcacatccggttatatttgtaatgagtgtattgaattatgtcatgat
atgttagctaatgcggatgacatcgaagaaattgatgaagaatttcaagaggaagagcct
aaattaccgacaccacatgaaattcgtgcacatttagatgattatgtcataggtcaagat
tatgctaaaaaagtattagctgtggcggtgtataatcattataaacgtttacgcagcgaa
aaaaatacttctgaggttgaattgggcaaaagtaatattttgcttatcggcccgacaggc
agtggcaaaactttattggcacaaacgttagctcgtatgctcaatgttccctttgcaatg
gcagatgcaacaactttaactgaagcgggatatgttggtgaagatgttgaaaatgtcttg
caaaaattattacaaaattgtgattatgatatagagaaagctcaacaaggtattatctat
attgatgaaattgataagattacacgtaagtctgaaaatccttctattactcgtgatgta
tcaggcgaaggtgtgcagcaggctttactaaaattagttgaaggaacggtagcttctatt
cctccacaaggcggacgaaagcatcctcaacaagaaatgttgcgtgtggacacctctaag
attttatttatttgtggcggtgcttttgccggtttagataaaattattgagaaaagaacg
aataccggcggcaaaggtattggttttggtgctgatgttcgtattgatgaagagaaagtt
agtttaaccgaattatttaagcaagttgaacctgatgatttaatgaaatttggcttaata
ccggagtttatcggtcgtttacctgttattgcacctttaagcgaactggatgaggaggct
ttggtaaaaattttaactgagccgaaaaatgccctaactaagcaatatcaagttttattc
agcttagaaaatattgaattagaatttacccaagaagcattgattgcaatggcgaaaaaa
gcactagctcgtaaaacaggtgccagaggtttgcgatctattgttgaaaccctattgctt
gatactatgtatgatctcccttctattgaaaacttacagaaagttatagtggaagaagaa
acagtcaccgaaaataaagcgccagtattgaagttcaatagctaa

DBGET integrated database retrieval system