KEGG   Histophilus somni 129PT: HS_1746Help
Entry
HS_1746           CDS       T00386                                 

Definition
(GenBank) conserved hypothetical protein
Organism
hso  Histophilus somni 129PT
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABI26014
UniProt: Q0I5S3
Position
1973782..1974429
Genome map
AA seq 215 aa AA seqDB search
MKKSAFSLLIMGGMSATLIGCVQHPTQNQNSSPSVETQPLPASQTVIEKKLQQHLVNAEQ
VIVPDIYQTFDESTTQIVRQGRYTLVNTSPEEGQKYLLEQMVTVNMLPKKKSSNVVTVEQ
GLVRTLSGTGLRLCAGSHFNQTASLFSLPLPKIHHQFGPIKLREALQMLAGPAYYVTLND
ITRTVCFKTREKPLETDKKRIEIISTTTQTEVVDE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctgctttttcacttttaatcatgggtgggatgagtgcgacattaataggc
tgtgttcagcacccaacccaaaatcaaaacagctctccctctgttgaaacgcagcctttg
cctgcttctcaaactgttattgaaaaaaaacttcagcagcacttggtgaatgcagaacag
gtgattgttcccgacatttatcaaaccttcgatgagtcaactacacaaatagtccgtcag
gggcgttatacgctcgtcaatacctcaccggaggaggggcaaaaatatttactggagcag
atggttacggtaaatatgctaccaaagaaaaaaagctccaatgtggtaacggttgaacaa
ggtttagttcgtaccttgtcaggaacaggattgcgtctttgtgcaggctctcattttaat
caaaccgcatcactcttttcgctgccactccctaaaatccatcaccaatttggaccaatt
aagttgcgtgaagcactacaaatgcttgcgggtcccgcctattatgtgacgttaaatgat
attacccgtacagtgtgttttaaaactcgcgaaaaaccacttgaaacggataaaaaacgt
attgagattatttcaaccacaacgcaaaccgaggtggttgatgaataa

DBGET integrated database retrieval system