KEGG   Histophilus somni 129PT: HS_1760
Entry
HS_1760           CDS       T00386                                 

Definition
(GenBank) conserved hypothetical protein
Organism
hso  Histophilus somni 129PT
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ABI26028
UniProt: Q0I5Q9
Position
1982458..1983096
AA seq 212 aa
MSRLKSELNHKDRQLTVAKIAIVCITIICFALMFIIYTFPSTLKILLPPDLRAGSQRPWW
EVPPSTVYAFAYQTFQQLNRWTLDGTQDYEKNIEALKPFLTPSCEAFLQQDYEDRQRHSE
LRDRVRGVYEIPGRGFSNNRVIVHNRDSWTVNLDLSVDEYYKDEPVKRVLTRFPISIVRM
DIDSKRNPWGLGFNCYASIPLRLEVNESEEKK
NT seq 639 nt   +upstreamnt  +downstreamnt
atgagtagattgaaaagtgaactcaatcataaagatcgccaattaacagtagccaagatt
gcgatcgtttgcatcaccattatttgttttgccttaatgtttattatttacaccttccca
agtaccttgaaaatcttacttccccctgatttaagagcgggaagccagcgaccttggtgg
gaggttcccccttcaacagtgtatgcctttgcctatcaaactttccagcagcttaatcgc
tggacgctggatggcactcaagactatgaaaaaaacattgaagcattaaaacctttttta
acaccctcttgcgaggcttttttgcaacaggattatgaagacagacagcgtcatagtgaa
ttgcgtgatcgtgtcagaggtgtgtatgaaatcccaggacggggatttagtaataatcgc
gttattgttcacaaccgagacagttggacggtaaatttagatttaagtgtcgatgagtat
tacaaagatgaacccgttaaacgtgtattaacccgttttcctatcagtatcgtgcgaatg
gatattgattcaaagcgtaatccttggggattgggttttaactgctatgcctcaataccc
ttacgtttagaggtaaacgagagtgaggagaaaaaataa

DBGET integrated database retrieval system