KEGG   Histophilus somni 129PT: HS_1762
Entry
HS_1762           CDS       T00386                                 

Definition
(GenBank) conserved hypothetical protein
Organism
hso  Histophilus somni 129PT
SSDB
Motif
Pfam: TrbI Mod_r Fib_alpha XRCC4 Beta-APP YabA
Other DBs
NCBI-ProteinID: ABI26030
UniProt: Q0I5Q7
Position
1984004..1985425
AA seq 473 aa
MKANKMFIVIGAIIFLMVGGVSYLLFSGSSSPSRTKLSVLDTALKDLTPEEIRQLGLEGD
TKNDTVRTLIGAAKESHRRYEKVISQNEKILKENETLRKREQDVHQQVDDAVQSKTRELQ
NMVAILREEMLQLVEGRSQSNGPTAYQGNTANGIGVEEDTTLPIGNGQVGMRTEGTVQHV
EWVNPDDQIEDERDPAKIGFPNLHAFNTASGKKGLPFISGNDENDRDITSSGSSSEKQKS
KIAVYTIPENSTLMGSTSMTALLGRIPIGNAVNDPYPFKAIIGRDNLIANGIELPDIEQA
IVSGTATGDWTLSCVRGEVKSLTFVFNDGRIVTSGKGNEKIGWLSDPHGIPCIPGERKTN
APEYLGTHFLLAAAGAAAQGYSQAQTTTAVNGNTVVGAVTGQQGKYVVGQALGQGIQESA
NWFKERYGQNFDAIYVPPGHPVAIHIDKAIDIDYDLKGRKVKYSQLSRSSQLD
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaaagccaataagatgtttattgtcattggagcgattattttcttaatggttgggggt
gtatcctatttgttgtttagcggttcgtcatcaccttcaagaacaaaactcagtgtgttg
gataccgcacttaaagatctcacgccggaagaaatccgtcaacttggtttagaaggtgat
accaaaaatgacacggtacgtacgttaattggtgcagcgaaagaaagtcatcgtcgttat
gagaaagtgatctcacaaaatgaaaaaattctcaaagagaatgaaaccttgcgtaaacgt
gagcaagatgtacatcaacaagttgatgatgcagtacagagcaaaacgcgagagctacaa
aatatggtggcgatacttcgtgaagaaatgttgcagttggtagaggggcgttcgcagtct
aacggaccaaccgcttatcagggcaatacagccaatggtattggcgttgaggaagatacc
acattacctatcggaaatgggcaagtgggaatgaggacagagggtaccgtacagcacgtt
gaatgggtcaatcctgacgatcaaatcgaagatgagcgtgaccctgctaaaattggcttt
ccaaaccttcacgcatttaacaccgcatcgggtaagaagggattaccttttatttcgggt
aacgatgagaatgatcgtgacattacctcctcaggttcatcgagtgagaaacaaaaaagt
aaaatcgccgtttataccattcctgaaaactcaacgctgatgggatcaacgtcaatgacc
gccttattagggcgtatcccaattggcaatgcagtgaacgatccctacccgtttaaggcc
attattggacgagataatttaattgccaatggcattgaactgccggacatcgaacaagcc
attgtgtcagggacagcaacaggagattggaccttatcttgtgtgcgtggtgaggtaaaa
agtttgaccttcgtgttcaatgatgggcggattgttaccagtggcaaaggaaatgaaaaa
attggctggttatcagacccacacgggatcccttgcattcccggcgagcgaaaaactaat
gctccggaatatttaggcacgcatttcttgttggccgctgcaggggcagctgcacaaggc
tactcacaagcccaaactaccacggcggttaatggcaacacggttgtaggtgcagtaaca
gggcaacaaggcaaatatgtggtggggcaagcacttggacaaggtatccaagaaagtgca
aattggtttaaagagcgttatgggcaaaattttgatgctatttatgtgccgccaggacac
cctgttgcgattcatattgataaagccattgacattgattacgacctaaaaggacgtaaa
gtgaaatacagtcaattgtcccgttcatctcagcttgattaa

DBGET integrated database retrieval system