KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105180970Help
Entry
105180970         CDS       T03918                                 

Definition
(RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial isoform X1
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00020  Citrate cycle (TCA cycle)
hst00640  Propanoate metabolism
hst01100  Metabolic pathways
hst01200  Carbon metabolism
Module
hst_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hst_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105180970
   00640 Propanoate metabolism
    105180970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hst04147]
    105180970
Enzymes [BR:hst01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     105180970
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     105180970
Exosome [BR:hst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105180970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 105180970
NCBI-ProteinID: XP_011135673
Position
Unknown
AA seq 424 aa AA seqDB search
MLRVLGRSMRSTHLFRRSIEAVCVSSTRNLNLLEYQSKELLRDCGVSVQNFAIVDDLTKT
NSALEKLHEGEYVIKAQILAGGRGKGWFDNGFKGGVHLTRDRNAVSNYVKNMLGHRLITK
QTSKDGIPVQKIMIAESVDIARETYVCILMDRAHNGPVLIASPAGGMDIETVAEKNPEQI
KTVPLDIYYGINDAIAKDVSIFLGFTDPDILDKAIYELKNLWKLFVDIDALQVEINPLVE
TKDKQVIAVDAKIAFDDNAQFRQQDLFALEDVTEKDPREVDASRFNLNYIGMDGNIGCLV
NGAGLAMATMDIIKLNGGSPANFLDVGGNVKEDQVFQAFRILSEDPKVKAIFVNVFGGIV
NCATIAKGIIAASRNLGLQIPLVVRLEGTNVTEAKKVLAESGLPILTANNLDEAAKKAVI
SVKA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgagttcttggccgttccatgcgctcgacgcatctcttcagaagaagcatagag
gcagtttgcgtgtcgagcacgagaaatttaaatctactggagtatcagagcaaagaactt
ctacgtgactgtggcgtgtcagtgcaaaactttgccatcgtcgatgacttaaccaagacg
aattccgccttggagaagttgcatgagggtgaatatgtaattaaggcccaaatcttagct
ggtggtcgtggtaaaggttggtttgataatggatttaaaggaggtgtacaccttaccaga
gaccgcaatgctgtctccaattatgtgaagaatatgcttggtcatcggcttattactaaa
caaacctcgaaagatggcataccagtgcagaaaattatgatcgccgagtcagttgatatt
gcacgtgagacttatgtctgtattctcatggatcgagcacataacggtccggtattgata
gcatctcccgccggtggtatggatattgagactgtggcagaaaagaatcccgaacagatc
aaaaccgttccgttggatatctattacggaattaacgatgccatagcgaaagatgtgagc
atcttcttgggattcactgatcccgatatcctggataaagccatatacgaattgaagaat
ctatggaagctattcgtggacattgacgcacttcaggttgaaattaatccattggtggag
acgaaagacaagcaagttatagcagtagatgcgaaaatcgcattcgacgataatgctcaa
tttaggcagcaagatttgtttgcgttggaggatgttaccgaaaaagatcctcgcgaagtg
gatgcatcgcgttttaacttaaattacattggcatggatggcaatataggatgtttagta
aatggagctggcttagccatggctacaatggatatcatcaaattaaatggaggatcgcct
gccaactttctagacgttggtggtaatgtgaaagaagaccaagtcttccaagcatttaga
attctcagtgaagatccaaaagtcaaagctattttcgtgaacgttttcggaggtatcgtg
aattgtgcaacaatagcgaaaggaattatcgcggcatcgcgtaatttaggacttcaaata
ccgctcgttgtgaggctagaaggcactaatgtgacagaagccaaaaaagttttagccgaa
tcggggttgccaattctcacagcgaataacttagatgaggcggcgaaaaaagcggtaatc
tctgtgaaagcgtaa

DBGET integrated database retrieval system