KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105181783Help
Entry
105181783         CDS       T03918                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase isoform X1
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
KEGG Orthology (KO) [BR:hst00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hst01009]
    105181783
Enzymes [BR:hst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     105181783
Protein phosphatases and associated proteins [BR:hst01009]
 HAD phosphatases
  Other HAD phosphatases
   105181783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD
Motif
Other DBs
NCBI-GeneID: 105181783
NCBI-ProteinID: XP_025158323
Position
Unknown
AA seq 228 aa AA seqDB search
MDFKKVTHCIFDMDGLLLDTETLYTVAYNRVTQEFGKTYTWQHKAKIMGFKSTDAVQTII
DILELPIMVQEFEDKLTTLYQELFPQCNLMPGVERLLRHLKENNIPIALATSSSQESSDL
KTQRWKHIFDYFDHKVYGGSDPEVPQGKPSPDIFLIAARRFPDNPDPSKCLVFEDSPNGV
QAAIAAKMQVVMVPDPQLPKQLMKDATLVLKSLEDFKPESFGLPPIIA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggatttcaagaaagttactcattgcattttcgatatggatggtttgttactggataca
gaaacattgtacacagtggcatacaatcgtgtgactcaagaatttggaaaaacatatact
tggcaacataaggcaaaaattatgggatttaagagcactgatgctgtacaaactataata
gacatattagaactaccaatcatggtgcaagaatttgaggacaagcttactactttgtac
caagaactatttcctcaatgtaatcttatgccaggtgtggagagactcctacgacatctc
aaagaaaacaatatacctattgcactagctacaagttcaagtcaagaaagcagtgacctg
aagacccagagatggaagcatatatttgactatttcgatcataaggtatatggtggttct
gatcctgaagttccgcaaggaaaaccaagtccagatatatttttaattgctgcaagacgt
ttccctgacaatcctgatccttcaaagtgcttagtctttgaagattcaccaaatggagta
caagctgctatcgctgctaagatgcaagtggtgatggtgccagaccctcaacttcctaaa
caactcatgaaagatgctacactggttttaaaaagcctagaagactttaaaccagagagc
tttggattacccccaattatagcatga

DBGET integrated database retrieval system