KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105182862Help
Entry
105182862         CDS       T03918                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog isoform X1
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
KEGG Orthology (KO) [BR:hst00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hst04131]
    105182862
Membrane trafficking [BR:hst04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    105182862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_2 WD40 zf-RING_5 Vps39_1 ANAPC4_WD40 zf-RING_2 TPR_2 TPR_7 zf-C3H2C3 zf-RING_UBOX zf-C3HC4_2
Motif
Other DBs
NCBI-GeneID: 105182862
NCBI-ProteinID: XP_011138911
Position
Unknown
AA seq 846 aa AA seqDB search
METTLNKDEQNNQDDSDSSEIDEVEPRLKYMRIRNDLEHILQNDAASCIAVHPKFLCLGS
HWGMIHLLDHQGNNVKSKTLQAHTVAVNQISIDHNGDFIASCSDDGKVFIYGLYSTENNH
NMSMGRLVKSIAIDPNYYKSGSGRRFITGDDKLVLYEKTFLARMKSTILCEAEGGVKSVA
WSSRFVAWASDTGVRVYDLDARCSLGLIKWSRTADASPEHYRCNLQWSDDKTLLIGWVDV
VRVCQIRKRTMQEMVNRDLPEFVVDPVSTFQVDFYISGIAPLGNQLVLLGCLKTLDENGK
SQRPTLHVVEPNGQDFSVICANSLTLRGYKEYSCNDYHLDCLKEENRFFIVSPKDIVVAS
LYDADDRIDWLLNHGKFEQALEAVTTNGKDCKKHTLLYVGRTYLDHLLKYQRYDEAGKLC
LKILGRNKKLWEEEVYKFARVHQLRSISSYLPRGDITLDPLIYEMVLYEYLKMDPDGFLH
LVKEWSPNLYTVAAVVNGVLEHLLVHNQRQNVLLEALAILYIYDGKYDKALAMYLKLRHK
DVFQLIQKYQLYSSVYEMIEGLMDLDTERAIQFFLEKDRVPSEVVVQKLQHNQRYLYLYL
DALDKKDTKDSKGKYHDLLIRLYADYSRDKLLPLLRRSDSYPIQQALDICSQRQFYPEMV
YLLGRMGNTSEALALMTRELNDMESAIAFCQEHDDKELWNDLVNYSLDKPAAITFLLQRI
GTYVDPRLMVQRIEPTLKIPGLKRALVKMMCDYNLQVSVQEGCKKILSNDYFNLHERLVR
CHQKGIFIDDDQMCGACHRKIIVREPRDMVVFYCKHSFHEDCLPNFELVENCVICNSQKE
MTPGRK
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaacactaaataaagatgagcagaataatcaagatgactcggattcttcagaa
attgatgaagtagaacctagattaaagtatatgagaattcgcaatgatctagaacatatc
ctacagaatgatgcagctagctgcattgctgtacatccaaagtttctctgtctagggtca
cattggggaatgattcatcttttggaccaccaggggaacaatgtaaagtctaaaacatta
caggcacatacagtggcagtcaatcagatttccatagaccataatggtgacttcattgct
tcttgtagtgatgatggaaaggttttcatttatggactatatagtacagagaacaatcat
aacatgagtatgggcaggctggtaaaaagtatagcgattgacccaaattattacaaaagt
ggcagtggcaggagatttattacaggtgatgacaaattggtgctttacgagaagactttc
ctggccagaatgaagtcaactatactttgtgaggcggagggtggagtaaaatctgttgct
tggtctagtcgttttgtcgcttgggcctccgatactggcgtgagagtttatgatctcgat
gctagatgttcactgggactgatcaagtggtctcgtacagcagacgcatcgccagaacat
tataggtgcaatttgcagtggtcggacgataaaacgctgctgataggatgggtggatgtt
gtacgggtctgtcagattaggaaacgtactatgcaagagatggtaaatcgagacttgcct
gaatttgtagtggatccagtgtcaacattccaagtggatttttacatatccggtattgcg
ccattgggaaatcagttggtattgttgggatgtttaaaaactctggatgaaaatggaaaa
agccagcgtccgaccttacatgtggttgaacctaatggtcaagatttttcagtgatatgc
gcaaactcactcactctacgtggctacaaagaatatagctgcaacgattatcatctagac
tgtttaaaagaggaaaacagattttttatcgtcagtccaaaagacattgtagtagccagt
ttatatgatgcagacgataggatcgattggctgttaaatcatggaaaattcgaacaagct
ctagaagcagtgacaacaaacggcaaagactgcaaaaaacatacgttattgtacgtgggt
cgtacttatttggatcacctgttaaaatatcaaaggtacgacgaggctgggaaactttgc
ctcaaaattttagggcgaaacaaaaaattgtgggaggaagaggtttacaaattcgccaga
gtgcatcaactacgttccatctcgtcttatttgcctcgaggtgatatcaccctcgatcca
ttgatttatgagatggtactgtacgagtacctaaagatggatcccgacggcttcttgcat
ctggttaaagagtggtccccgaatttatacacagtggcagcagtagttaacggcgtgttg
gagcatttactagtccacaatcagcgacagaacgtattattggaagcactggcaattttg
tatatctacgatggcaaatacgacaaagcactcgctatgtacttgaagctgcgacacaaa
gatgtcttccaattgatccaaaagtaccagttgtacagttcggtatatgaaatgatcgaa
ggtctaatggatctggacacggaacgtgccatacagttcttcttggagaaagaccgagtt
ccgtctgaagttgttgtgcagaaacttcagcataatcaacgttacttatacctgtatttg
gacgccttagataaaaaagatacaaaggattctaaaggcaagtatcacgacttgctgata
cgattgtacgctgattattcgagggacaagctgctgccactcttacgtcgctctgatagt
tatccgatacagcaagccttggatatatgtagtcagcgtcaattttatcccgaaatggtg
taccttttgggtagaatgggaaacacttcagaagctttggcgctcatgacaagggaactc
aatgatatggagagtgccatcgcgttttgtcaagaacacgatgataaagaactgtggaac
gatctagttaattactcgctcgataaacctgcggctattaccttccttctccaaagaatt
ggtacctacgtcgatccacgactcatggtacaaaggatagagcccactttaaaaattcca
ggactaaaaagagcattggtcaagatgatgtgtgactataatctgcaggtgtccgtgcaa
gaaggttgtaagaagattctgtccaatgattacttcaatcttcacgagaggctcgttcgt
tgtcaccagaaaggcatatttatcgacgacgaccaaatgtgtggagcttgccataggaag
ataattgtaagagagccacgggacatggttgtattttattgtaagcactctttccatgag
gattgtctgcctaactttgaattggttgaaaattgtgtaatatgcaattcacagaaggaa
atgacgcctggtagaaaatga

DBGET integrated database retrieval system