KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105183514Help
Entry
105183514         CDS       T03918                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00051  Fructose and mannose metabolism
hst00520  Amino sugar and nucleotide sugar metabolism
hst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    105183514
   00520 Amino sugar and nucleotide sugar metabolism
    105183514
Enzymes [BR:hst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     105183514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Fucokinase Hexapep_2
Motif
Other DBs
NCBI-GeneID: 105183514
NCBI-ProteinID: XP_011140021
UniProt: E2BJI4
Position
Unknown
AA seq 419 aa AA seqDB search
MLKAVILIGGPLKGTRFRPLSLDIPKPLFPVAGLPMIQHHIEAYTKVPGLNEVLIIGAYP
KNDLSQFVQQMSSTYGIVIRYLQEFTPLGTAGGMYHFRDQIRSGSPSCFFIMNGDVCADF
PLLEMVEFHKDKQALLTIMATEATRQQSLNYGCMVLGKEGEVAHYVEKPSTFVSALINCG
VYLASLEIFQTMADVFHANQQQDLIMQSYGNGRDPAHIAFEQDILTRLAGSGRLFALPVL
RWWSQVKTAGSAIYANRHYLALYKQKQPNHLASMSKDSCNIIGDVYIHPSATVHPTSTLG
PNVSIGPNTIIEPGVRIRESIVLANTHIQAHSLILYSIIGTGTSVGEWARVEGTPCDPNP
NKPFAKMENLPLFNVNGKLNPSITILGTSVSLAAEKILLNSIVLPHKELTRNYKNEIIL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggcagttatcttaattggaggaccattgaaaggaacaaggtttaggcctctt
tctctggacatcccaaaaccactgttcccagtggctgggttacccatgatacaacatcac
attgaggcatataccaaagtgcctggtctcaatgaagtattgataatcggcgcttatccc
aagaacgatttatctcagtttgtacaacagatgtcgagtacctatggcatagttattaga
tacctgcaggaatttactccgcttggaacagcaggaggcatgtatcactttcgtgatcag
atacgttcgggcagtccatcatgcttttttataatgaatggggatgtctgtgctgacttt
cctctattggaaatggtggaatttcataaggacaagcaggccctgctcacaatcatggct
acagaagcaactcgtcagcagtccttgaattacggatgtatggttttgggcaaagaagga
gaagtggcgcattatgtcgaaaaaccttccacatttgtatcagcccttatcaactgtgga
gtatatctagcctccctagaaatcttccaaacaatggcggatgtctttcatgctaatcag
cagcaagatcttataatgcagtcgtatggcaatggcagagatccagcgcacattgcgttc
gagcaggacatactgacacgtttggcaggaagcggtcgattgtttgctctgcctgtgctc
agatggtggtcgcaggtgaaaaccgcaggatctgcgatatatgccaatcgacactatttg
gcactctacaagcagaaacagccaaaccatttggcttcgatgagcaaagattcttgtaac
atcataggagatgtatatattcatccatcagccactgtacatccaacttccacgctaggt
cccaatgttagtataggtccaaatacaattattgagcctggtgtgagaatcagagaatcg
attgtattggccaacacacacatacaggctcattctctcatcttatatagcatcatagga
acaggtaccagtgtgggtgaatgggcacgagtcgaggggactccttgtgatccaaatcct
aacaagccgtttgcgaaaatggagaacttaccattgtttaatgtcaacggcaaactcaat
ccttccatcacgatacttggcaccagcgtgagcttggccgcggagaaaattctgctgaac
tcgatcgttttgccgcataaggaactgacgagaaactataaaaacgaaattattctctag

DBGET integrated database retrieval system